DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppp4c

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_599186.1 Gene:Ppp4c / 171366 RGDID:621225 Length:307 Species:Rattus norvegicus


Alignment Length:295 Identity:128/295 - (43%)
Similarity:190/295 - (64%) Gaps:9/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.||..|.||       ||...:.|:.:..:|..:||:.:.:..:..:.:||.:|||:||||.|
  Rat     4 ISDLDRQIEQL-------RRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYD 61

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |..:|:..|..|.:||||:||:||||..|:||..|||..|:|||:...|:||||||..:.:||||
  Rat    62 LKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGF 126

  Fly   152 FDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGL 215
            :|||.|:| |:.:||...:.:|.:.::|||..:||||||||||.:..||.||.::|..:||.||.
  Rat   127 YDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGP 191

  Fly   216 LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVT 280
            :||||||||::||| |..:.||..:.||:::|..|...:..::..||||:|.:||::..:..::|
  Rat   192 MCDLLWSDPEDTTG-WGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQLVMEGYKWHFNETVLT 255

  Fly   281 IFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP 315
            ::||||||....|..|:|.:|..|...|:|....|
  Rat   256 VWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 128/295 (43%)
MPP_superfamily 25..313 CDD:301300 126/288 (44%)
Ppp4cNP_599186.1 PTZ00239 6..307 CDD:173488 127/293 (43%)
MPP_PP2A_PP4_PP6 6..290 CDD:277360 126/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.