DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and UPS2

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_013269.1 Gene:UPS2 / 850865 SGDID:S000004158 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:69/219 - (31%)
Similarity:111/219 - (50%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVD--GVLHTHRLVQSKWYFPKW 63
            ||::.:.:.||:||:.||.|.|:||||.::..:|..||:.|.:.|  .||.|.||:..|...|||
Yeast     1 MKLFQNSYDFNYPWDQVTAANWKKYPNEISTHVIAVDVLRRELKDQGKVLVTERLITVKQGVPKW 65

  Fly    64 THALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSD-ASKTLLKQEAT 127
            ...::|........|.|.||..:|.:.:::.|||.|..:.|.|.:.|.|||.| |:|||.:|||.
Yeast    66 IMMMLGGTNMSHVREVSVVDLNKKSLTMRSCNLTMCNLLKVYETVTYSPHPDDSANKTLFQQEAQ 130

  Fly   128 VTVFGV--PLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIARGTDELLHNTRRSIDEV 190
            :|.:|.  .|.:.|||........||.||:.|.:.|:.:.:              .|..:.:|::
Yeast   131 ITAYGSIRKLCNKMEDWSVQRFCENAKKGKMGFDAVLQVFS--------------ENWEKHVDDL 181

  Fly   191 T----ESARKSMDEISAQAAKAAK 210
            :    ....::|:::...|....|
Yeast   182 SNQLVSKVNETMEDVKISAGTLLK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 58/157 (37%)
UPS2NP_013269.1 PRELI 15..172 CDD:398400 58/170 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341990
Domainoid 1 1.000 102 1.000 Domainoid score I1521
eggNOG 1 0.900 - - E1_KOG3336
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I1303
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54780
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - otm46643
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1609
SonicParanoid 1 1.000 - - X1543
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.