DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and AT5G13070

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_196811.1 Gene:AT5G13070 / 831146 AraportID:AT5G13070 Length:183 Species:Arabidopsis thaliana


Alignment Length:181 Identity:54/181 - (29%)
Similarity:90/181 - (49%) Gaps:16/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWTSEHIFNHPWETVTQAAWRKYPNP----MTPSIIGTDVVERRV--VDGVLHTHRLVQSKWY 59
            :|.:..||::.||||.|:.|:|||:.:|    :...|:..|.:.|::  ..|.|||.|.:.....
plant     2 VKAYRQEHVYKHPWERVSAASWRKFADPENKRILSHILEVDTLNRKLDTETGKLHTTRALTIHAP 66

  Fly    60 FPKWTHALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASK-TLLK 123
            .|.:.|.:|| ...|...|.:.||.:.:.|.|.|.|::..:.|.|:|.:.|:|||.:.|. |:..
plant    67 GPWFLHRIIG-QDICHCVESTVVDGKSRSMQLTTKNISLKKFIEVEERIRYDPHPDNPSAWTVCS 130

  Fly   124 QEATVTVFGVPLS------HYMEDLLTSTISTNAGKGRQGLEWVIGLINTE 168
            ||.::.:  .|||      ..:|.........|:.|||:.:|.:...:..|
plant   131 QETSIRI--KPLSALASMAEKVEQKCAEKFMQNSAKGREVMERICKYMEAE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 47/165 (28%)
AT5G13070NP_196811.1 PRELI 16..179 CDD:398400 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3336
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56106
Inparanoid 1 1.050 82 1.000 Inparanoid score I2354
OMA 1 1.010 - - QHG54780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - oto3463
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.