DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and Prelid3a

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_038953059.1 Gene:Prelid3a / 690253 RGDID:1582858 Length:305 Species:Rattus norvegicus


Alignment Length:175 Identity:76/175 - (43%)
Similarity:106/175 - (60%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HIFN--------HPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGV--LHTHRLVQSKWYFPK 62
            ||||        |||:||.:||.|||||||.|.::|.||:||. |||.  ||:.||:.::|..|.
  Rat   122 HIFNPALRRQSSHPWDTVIKAAMRKYPNPMNPCVVGVDVLERS-VDGYGRLHSLRLLSTEWGLPG 185

  Fly    63 WTHALIGTAKT-CFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEA 126
            ...|::|..:| .:..|||.|||..::|.|.:.|:|....:||:|.|.|.|||.:..||:|.|||
  Rat   186 LVRAILGANRTLTYIKERSVVDPAARKMELCSTNITLTNLVSVNERLVYTPHPENPEKTVLTQEA 250

  Fly   127 TVTVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKG 171
            .:||.|:.|..|:|.|:.:|||:||.|           ::|.|:|
  Rat   251 IITVKGISLGSYLESLMATTISSNAKK-----------VHTSVEG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 66/155 (43%)
Prelid3aXP_038953059.1 POM121 <6..101 CDD:405826
PRELI 137..277 CDD:398400 65/140 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336846
Domainoid 1 1.000 165 1.000 Domainoid score I3828
eggNOG 1 0.900 - - E1_KOG3336
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3694
OMA 1 1.010 - - QHG54780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - otm44861
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - O PTHR11158
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.