DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and Prelid2

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001258262.1 Gene:Prelid2 / 681037 RGDID:1584707 Length:177 Species:Rattus norvegicus


Alignment Length:158 Identity:34/158 - (21%)
Similarity:74/158 - (46%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVD--GVLHTHRLVQSKWYFPKWTHAL-IGT 70
            :|.:|:|.|.....|||||||..::|....||.:..:  |:::..|:...:...|:....: |..
  Rat    10 VFQYPFEQVVACFLRKYPNPMDKNVISVKTVEEKKDESTGLIYRKRIAICQNVVPEVLRKVSILK 74

  Fly    71 AKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATVTVFGVP- 134
            .......|.|.:..:::.|.::::.||:.:..|:.|...:.....:.:.|...|...:::.|.. 
  Rat    75 VPDIQLEEESWLSLQKRNMAIRSHCLTWTQYASMREESVFRESVENPNWTEFIQTGRISITGAGF 139

  Fly   135 LSHYMEDLLTSTISTNAGKGRQGLEWVI 162
            |:..:|...::.:...|.||.:.:|.::
  Rat   140 LNCILETFASTFLRQGAQKGIRIMEMLL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 32/152 (21%)
Prelid2NP_001258262.1 PRELI 16..173 CDD:282550 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.