DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and Prelid3b

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001009543.1 Gene:Prelid3b / 494346 RGDID:1594395 Length:195 Species:Rattus norvegicus


Alignment Length:208 Identity:104/208 - (50%)
Similarity:135/208 - (64%) Gaps:20/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRV-VDGVLHTHRLVQSKWYFPKWT 64
            ||||||||:|:|||||||.||.:||||||.||::|.||::|.| ..|.||:|||:.::|..|...
  Rat     1 MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHVDPSGKLHSHRLLSTEWGLPSIV 65

  Fly    65 HALIGTAKT-CFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATV 128
            .:|||.|:| .:..|.|.|||.|:.|.||:.|::|...:||||.|.|:|||.|..||:|.|||.:
  Rat    66 KSLIGAARTKTYVQEHSVVDPIRRTMELKSTNISFTNMVSVDERLTYKPHPQDPEKTVLTQEALI 130

  Fly   129 TVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIARGTDELLHNTRRSIDEVTES 193
            ||.||.||.|:|.|:.||||:||.|||:.:||||..:|.|                  |:|:..|
  Rat   131 TVKGVSLSSYLEGLMASTISSNANKGREAMEWVIHKLNAE------------------IEELAAS 177

  Fly   194 ARKSMDEISAQAA 206
            ||.|:....|.||
  Rat   178 ARGSIRTPMAAAA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 82/154 (53%)
Prelid3bNP_001009543.1 PRELI 15..170 CDD:398400 82/154 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3828
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56106
Inparanoid 1 1.050 201 1.000 Inparanoid score I3694
OMA 1 1.010 - - QHG54780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - otm44861
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1543
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.