DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and prelid1a

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956660.1 Gene:prelid1a / 393337 ZFINID:ZDB-GENE-040426-1341 Length:210 Species:Danio rerio


Alignment Length:199 Identity:49/199 - (24%)
Similarity:101/199 - (50%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WETVTQAAWRKYPNPMTPSIIGTDVVERRVV-DGVLHTHRLVQSKWYFPKWTHALIGT--AKTCF 75
            |:.|:.|.|::||||.:..::..|::.|.|. |..|.:.||:......|:|....:..  |:..:
Zfish    15 WDQVSSAFWQRYPNPYSNHVLTEDIIFREVTPDNCLKSRRLLTKTSRAPRWAEKFLPAHMAQKAY 79

  Fly    76 ASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATVT--VFGVPLSHY 138
            ..|.|.|||:.|.:...|.|::..|.:|::|...|:.:|.::|.|.::::|.::  ::|  ||..
Zfish    80 IIEDSVVDPQGKTLTTLTWNISHARVMSIEERCVYKVNPENSSWTEIERQAWISSKLYG--LSRA 142

  Fly   139 MEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIARGTDELLHNTRRSIDEVTESARKSMDEISA 203
            :::...:...:|..|..:|.|:::..:..|:.     |..|.........|...:|::...::::
Zfish   143 IQEFGLARFKSNVTKTMKGFEYILAKMQGEMP-----TRTLAETATVKARETALAAKEKAKDLAS 202

  Fly   204 QAAK 207
            ||.|
Zfish   203 QAQK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 40/157 (25%)
prelid1aNP_956660.1 PRELI 16..172 CDD:282550 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.