DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and prelid3b

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956028.1 Gene:prelid3b / 378855 ZFINID:ZDB-GENE-031002-13 Length:193 Species:Danio rerio


Alignment Length:181 Identity:101/181 - (55%)
Similarity:130/181 - (71%) Gaps:5/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRV-VDGVLHTHRLVQSKWYFPKWT 64
            ||||||||||||||||||:||.:||||||.||:.|.||::|.| ..|.||:.||:.::|..|...
Zfish     1 MKIWTSEHIFNHPWETVTKAAMQKYPNPMNPSVFGVDVLDRNVDQQGRLHSKRLLSTEWGLPSIV 65

  Fly    65 HALIGTAKTC-FASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATV 128
            .:|||..:|| :..|:|.|||:.|...|::.|:||...:||||.|.|.|||.|..||:|.|||.:
Zfish    66 RSLIGNTRTCTYIQEQSVVDPKEKTFELQSTNITFTNMVSVDERLIYRPHPEDPEKTMLTQEAII 130

  Fly   129 TVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGI---ARGT 176
            :|.||.||.|:|.|:.|||||||||||:.:||||..:|||::.:   ||||
Zfish   131 SVKGVSLSSYLEGLMASTISTNAGKGREAMEWVIRRLNTEIEELAMTARGT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 81/154 (53%)
prelid3bNP_956028.1 PRELI 15..170 CDD:282550 81/154 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575996
Domainoid 1 1.000 165 1.000 Domainoid score I3870
eggNOG 1 0.900 - - E1_KOG3336
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56106
Inparanoid 1 1.050 207 1.000 Inparanoid score I3679
OMA 1 1.010 - - QHG54780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - otm24940
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1609
SonicParanoid 1 1.000 - - X1543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.