DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and prel

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001260824.1 Gene:prel / 35969 FlyBaseID:FBgn0033413 Length:236 Species:Drosophila melanogaster


Alignment Length:228 Identity:50/228 - (21%)
Similarity:88/228 - (38%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGVLHTHRLVQSKWYFPKWTHALIGT 70
            :|.:|::.|..|..|.|.:||||.:..::..|.::|.|.||.|.:.||:......|||.......
  Fly    10 TETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDGKLFSRRLLSKTNPVPKWGARFYNN 74

  Fly    71 AKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATVTVFGVPL 135
            ...... |.|.:||.:|.....|.||...:.:.|||::.|......::..:.:...:..|||  .
  Fly    75 VPVKIV-EDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVYSEQKDGSTLAVRRAYISSQVFG--F 136

  Fly   136 SHYMEDLLTSTISTNAGKGRQGLEWVI----------------GLINTEVKGIARGTDELLHNTR 184
            |..:..........|..|...|..:|:                .:..|...|....|...:..|.
  Fly   137 SRAIRAFGIERFKANGNKASNGFNYVLRRMFPDSLVGGGHHQHAVTTTSPAGELPATTITVSTTN 201

  Fly   185 RSIDE---VTESARKSMDEISAQAAKAAKAMHI 214
            .|::.   :..:|:...:...:.|:|.|:...:
  Fly   202 GSLNNQGALKSAAKVGYEFFKSHASKIAQLFSV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 38/168 (23%)
prelNP_001260824.1 PRELI 21..164 CDD:282550 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11158
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.