DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and F15D3.6

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_492952.1 Gene:F15D3.6 / 173040 WormBaseID:WBGene00008856 Length:209 Species:Caenorhabditis elegans


Alignment Length:207 Identity:84/207 - (40%)
Similarity:118/207 - (57%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGVLHTHRLVQSKWYFPKWTH 65
            |:||:|||||:|.||||.|||:||||||:..||.|.|||::.:..|.:.|.|::||.:..|.|..
 Worm     1 MRIWSSEHIFDHEWETVAQAAFRKYPNPLNRSITGIDVVKQTLEAGKILTERIIQSHFSIPSWAT 65

  Fly    66 ALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATVTV 130
            .|.|.:.|.::.|.:.:||.||:..|.|.||.....:.|||.|.|.|...|.:||:|||:..||:
 Worm    66 KLTGFSGTQYSHEYTVIDPTRKEFSLTTRNLNGSSFLRVDEKLTYTPAHEDPNKTILKQDVIVTI 130

  Fly   131 FGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIARGTDELLHNTRRSIDEVTESAR 195
            .....:.|.|....|..|.||.|||||:||||..:..|.:.|:......:|       |::|...
 Worm   131 TLPAFADYCEKTFLSIYSQNANKGRQGVEWVIDHLKKEYEAISTKVSSEVH-------EMSEKVL 188

  Fly   196 KSMDEISAQAAK 207
            :|....|:.:.|
 Worm   189 RSFGTTSSSSPK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 66/152 (43%)
F15D3.6NP_492952.1 PRELI 15..168 CDD:368069 66/152 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157482
Domainoid 1 1.000 126 1.000 Domainoid score I3369
eggNOG 1 0.900 - - E1_KOG3336
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56106
Inparanoid 1 1.050 158 1.000 Inparanoid score I2902
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 1 1.000 - - oto20811
orthoMCL 1 0.900 - - OOG6_102353
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1609
SonicParanoid 1 1.000 - - X1543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.