DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and PRELID2

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_016864616.1 Gene:PRELID2 / 153768 HGNCID:28306 Length:194 Species:Homo sapiens


Alignment Length:166 Identity:36/166 - (21%)
Similarity:70/166 - (42%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFNHPWETVTQAAWRKYPNPMTPSIIGTDVVE--RRVVDGVLHTHRLVQSKWYFPK--------- 62
            ::.:|:|.|..:..|||||||..::|...::|  |....||::..|:...:...|:         
Human    10 VYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQNVVPEILRKSLSTL 74

  Fly    63 ----WTHALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLK 123
                |....|.........|.|.::|..:.|.::::.||:.:..|:.|...:.....:.:.|...
Human    75 VILCWKKVSILKVPNIQLEEESWLNPRERNMAIRSHCLTWTQYASMKEESVFRESMENPNWTEFI 139

  Fly   124 QEATVTVFGVPLSHYMEDLLTSTISTNAGKGRQGLE 159
            |...:::.||...:.:.:...||..      |||.:
Human   140 QRGRISITGVGFLNCVLETFASTFL------RQGAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 35/160 (22%)
PRELID2XP_016864616.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.