DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmo and prelid3a

DIOPT Version :9

Sequence 1:NP_001097094.1 Gene:slmo / 44132 FlyBaseID:FBgn0029161 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_012819745.1 Gene:prelid3a / 100145262 XenbaseID:XB-GENE-5804616 Length:190 Species:Xenopus tropicalis


Alignment Length:153 Identity:75/153 - (49%)
Similarity:103/153 - (67%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HPWETVTQAAWRKYPNPMTPSIIGTDVVERRV-VDGVLHTHRLVQSKWYFPKWTHALIGTAKT-C 74
            |||:||.:||.|||||||.|.::|.|||:|.: ..|.||:.||:.::|..|....|::||.:| .
 Frog    30 HPWDTVIKAAMRKYPNPMNPCVVGVDVVDRNLDPQGRLHSQRLLCTEWGLPSLVRAILGTNRTLT 94

  Fly    75 FASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKTLLKQEATVTVFGVPLSHYM 139
            :..|.|.|||..|:|||.:.|::....:||||.|.|.|||.:..:|:|.|||.:||.||.||.|:
 Frog    95 YIKEHSVVDPIEKKMVLCSTNISLTNLVSVDERLVYTPHPENPEETVLTQEAIITVKGVSLSSYL 159

  Fly   140 EDLLTSTISTNAGKGRQGLEWVI 162
            |.|:.||||:||.||...:||:|
 Frog   160 EGLMASTISSNARKGWDAIEWII 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmoNP_001097094.1 PRELI 15..168 CDD:398400 72/150 (48%)
prelid3aXP_012819745.1 PRELI 33..183 CDD:368069 72/150 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002094
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11158
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1609
SonicParanoid 1 1.000 - - X1543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.