DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and LEE1

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_015271.1 Gene:LEE1 / 856053 SGDID:S000005975 Length:301 Species:Saccharomyces cerevisiae


Alignment Length:46 Identity:20/46 - (43%)
Similarity:24/46 - (52%) Gaps:8/46 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 CKYFKKGEGKCPFGNKCFYKHALPNG------DIVDVGLPKRTRKL 341
            ||||.|  |.|.|||||...|.||||      :.:|:..|.:...|
Yeast   124 CKYFAK--GNCKFGNKCVNAHVLPNGFKMNSKEPIDITPPSQNNYL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632
RING 213..267 CDD:238093
LEE1NP_015271.1 YTH1 1..301 CDD:227416 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.