powered by:
Protein Alignment Mkrn1 and LEE1
DIOPT Version :9
Sequence 1: | NP_001246867.1 |
Gene: | Mkrn1 / 44131 |
FlyBaseID: | FBgn0029152 |
Length: | 386 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015271.1 |
Gene: | LEE1 / 856053 |
SGDID: | S000005975 |
Length: | 301 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 46 |
Identity: | 20/46 - (43%) |
Similarity: | 24/46 - (52%) |
Gaps: | 8/46 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 CKYFKKGEGKCPFGNKCFYKHALPNG------DIVDVGLPKRTRKL 341
||||.| |.|.|||||...|.|||| :.:|:..|.:...|
Yeast 124 CKYFAK--GNCKFGNKCVNAHVLPNGFKMNSKEPIDITPPSQNNYL 167
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mkrn1 | NP_001246867.1 |
ZnF_C3H1 |
20..43 |
CDD:214632 |
|
RING |
213..267 |
CDD:238093 |
|
LEE1 | NP_015271.1 |
YTH1 |
1..301 |
CDD:227416 |
20/46 (43%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157343623 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1039 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.