DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and AT5G18550

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_197356.2 Gene:AT5G18550 / 831973 AraportID:AT5G18550 Length:465 Species:Arabidopsis thaliana


Alignment Length:341 Identity:67/341 - (19%)
Similarity:104/341 - (30%) Gaps:108/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVTSSDTAISGMALGRSQTICRYYVR-GICRFGELCRFSHDLSRGRPECEEQVATDVLPKPSTSS 66
            :||.......|..|...:..|.|::| |.|:||..||:.|.:..|            :..||   
plant   131 SVTPVSLNYMGFPLRPGEKECSYFMRTGQCKFGSTCRYHHPVPPG------------VQAPS--- 180

  Fly    67 SSTIGSRSASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVD-----PEAVMEAQAGASYDTL 126
                       ..||:..:..|...||.:..|.....::...:.     |.:.:::..|.....|
plant   181 -----------QQQQQQLSAGPTMYPSLQSQTVPSSQQYGVVLARPQLLPGSYVQSPYGYGQMVL 234

  Fly   127 APGV----SW----AEVVGGPSSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPTDQV 183
            .||:    .|    |.|...||.      |.:.|   .|..|.|.| ..|......|...|:.  
plant   235 PPGMVPYSGWNPYQASVSAMPSP------GTQPS---MGTSSVYGI-TPLSPSAPAYQSGPSS-- 287

  Fly   184 QRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHIFCLECIRT 248
            ...|:..:...|..:..|..:.:      ..|.|            :||  .:|           
plant   288 TGVSNKEQTFPQRPEQPECQYFM------RTGDC------------KFG--TSC----------- 321

  Fly   249 WRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAALGAKDCKYFKKGEGKCP 313
                 :|.:.:..|.||....|....|                   ...||..|.:|.: .|.|.
plant   322 -----RFHHPMEAASPEASTLSHIGLP-------------------LRPGAVPCTHFAQ-HGICK 361

  Fly   314 FGNKCFYKHALPNGDI 329
            ||..|.:.|:|.:..:
plant   362 FGPACKFDHSLGSSSL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 10/23 (43%)
RING 213..267 CDD:238093 9/53 (17%)
AT5G18550NP_197356.2 zf-CCCH 52..78 CDD:395517
zf-CCCH 99..124 CDD:395517
zf-CCCH 146..172 CDD:395517 10/25 (40%)
zf-CCCH 301..327 CDD:395517 7/61 (11%)
zf-CCCH 346..370 CDD:395517 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.