DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and Mkrn2

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_075779.2 Gene:Mkrn2 / 67027 MGIID:1914277 Length:416 Species:Mus musculus


Alignment Length:418 Identity:139/418 - (33%)
Similarity:213/418 - (50%) Gaps:67/418 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGRSQTICRYYVRGICRFGELCRFSHDLSRGRPE--CE---------------------EQVATD 57
            :...|..|||::.|:||.|..|.|||||:..:|.  |:                     ......
Mouse     1 MSTKQVTCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGARCRYDHTKPPAAAGGA 65

  Fly    58 VLPKPSTSSSSTIGSRSAS---ISSQQRNWANAP------VFVPSQKRYTAHEQSEFETT----- 108
            |.|.|:.|.||.:.|...|   .:|..|..:|.|      ..|...:..|...:.:...:     
Mouse    66 VGPAPNPSPSSGLHSPHPSPDIATSVMRTHSNEPGKREKKTLVLRDRNLTGLAEDKTPPSKVNNP 130

  Fly   109 ---VDPEAVMEAQAGASYDTLAPGVSWAEVVGGPSSLNKEDY-------GEENSSCAWGEFSAYP 163
               .||:...|.:..:..|.:..|:...|   ..||.:.|..       ||    |.:|:...| 
Mouse   131 GGCSDPQTSPEMKPHSYLDAIRTGLDDLE---ASSSYSNEPQLCPYAAAGE----CRFGDACVY- 187

  Fly   164 IHMELCEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKA-GR 227
            :|.::||:|....|||.|..||::|.:.|:...|..||.:||...|:||.|.||.:.|:||| ..
Mouse   188 LHGDMCEICRLQVLHPFDPEQRKAHEKMCMSTFEHEMEKAFAFQASQDKVCSICMEVILEKASAS 252

  Fly   228 EKRFGILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLND 292
            |:|||||.||:|.:||.|||.||.||||||.|.::||||||.|:||.||.:|:|.:.:|::|:..
Mouse   253 ERRFGILSNCSHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEA 317

  Fly   293 YRAALGAKDCKYFKKGEGKCPFGNKCFYKHALPNGDIVDVGLPKRTRK-LQSQNEIIDLLDIYLW 356
            ::..:|.|.||||::|:|.||||:||.|:||.|:|.:.:   |::.|| |.|:..:.....:.||
Mouse   318 FKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAE---PEKPRKQLSSEGTVRFFNSVRLW 379

  Fly   357 DYVDRRDYHWLEMISSDITSSESSDYSD 384
            |:::.|:       :..:.|::..|.::
Mouse   380 DFIENRE-------TRQVPSTDDVDVTE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 12/22 (55%)
RING 213..267 CDD:238093 33/54 (61%)
Mkrn2NP_075779.2 ZnF_C3H1 2..28 CDD:214632 12/25 (48%)
ZnF_C3H1 35..55 CDD:214632 1/19 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..144 17/82 (21%)
PHA03096 <178..327 CDD:222981 71/153 (46%)
Makorin-type Cys-His 193..222 11/28 (39%)
RING 238..292 CDD:238093 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8159
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3177
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58455
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm8837
orthoMCL 1 0.900 - - OOG6_103641
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X837
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.