DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and Mkrn3

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_038956927.1 Gene:Mkrn3 / 292988 RGDID:1311197 Length:528 Species:Rattus norvegicus


Alignment Length:371 Identity:142/371 - (38%)
Similarity:190/371 - (51%) Gaps:83/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QTICRYYVRGICRFGELCRFSHDLS-----RGRPECEEQVATDVLPK---------------PST 64
            |.:||||:.|.|:.|:.||:|||||     ||..:.:.:.:.|..||               |.|
  Rat    95 QILCRYYLHGQCKEGDNCRYSHDLSGRRKARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPT 159

  Fly    65 SSSST---IGSR-----------SASISSQ------------------------QRNWANAPVFV 91
            :|||:   |||.           :|.|.|.                        ...|..|..||
  Rat   160 ASSSSLPLIGSAAERGFSEAEIDNAGIGSAAERGFPEAEIDNAGLAAGAAGGAGAEGWEGAIEFV 224

  Fly    92 PSQ----KRYTAHEQSEFETTVDPEAVMEAQAGASYDTLAPGVSWAEVVGGPSSLNKEDYGEENS 152
            |.|    :....|         .|||.:::.. ...:.:|.|      :|.|..|.:  |. ...
  Rat   225 PGQPYRGRMIPPH---------GPEAPLQSPE-IEREHMAMG------MGMPLPLCR--YA-ARG 270

  Fly   153 SCAWGEFSAYPIHMELCEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGIC 217
            .|..|:..||| |.|:|:||.|..|||.|..|:.:|.|.|::.||:.||||||:.||.||.||||
  Rat   271 QCLRGDRCAYP-HGEICDMCGQQALHPWDAAQQEAHRRACVEAHERDMELSFAVQRSMDKVCGIC 334

  Fly   218 FDTIMEKAG-REKRFGILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWME 281
            .:.:.|||. .::|||||.:|||.:||:|||.||.|.||||:|:::||:|||.|.||.||.||:|
  Rat   335 MEVVYEKADPSDRRFGILFSCNHTYCLKCIRRWRSATQFENRISKSCPQCRVSSGFVIPSEFWVE 399

  Fly   282 TKEEKDKLLNDYRAALGAKDCKYFKKGEGKCPFGNKCFYKHALPNG 327
            .:|||:||:..|:..:..|.|:||..|.|.||||..|||||..|.|
  Rat   400 EEEEKEKLVQQYKEGMSQKACRYFAGGLGHCPFGEFCFYKHEYPEG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 12/22 (55%)
RING 213..267 CDD:238093 30/54 (56%)
Mkrn3XP_038956927.1 zf-CCCH_4 96..117 CDD:407881 10/20 (50%)
PHA03096 <272..420 CDD:222981 79/148 (53%)
RING-HC_MKRN1_3 328..388 CDD:319644 35/59 (59%)
MKRN1_C 442..528 CDD:406294 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7889
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3107
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm9084
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X837
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.