DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and SPCC1739.01

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_588409.2 Gene:SPCC1739.01 / 2539315 PomBaseID:SPCC1739.01 Length:547 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:38/169 - (22%)
Similarity:65/169 - (38%) Gaps:40/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSSDTAISGMALGRSQTICRYYVRGICRFGELCRFSHDLSRGRPECEEQVATDVLPK-PSTSSSS 68
            |:.:......:|...:.||:|:::|.|:||..|..||.|. |........:|:.:.. .:...:|
pombe    56 TAGENCPFSHSLETERPICKYFLKGNCKFGPKCALSHALP-GNTNLPNGTSTNTMASMAANGGAS 119

  Fly    69 TIGSR-------SASISSQ-----------------QRNWANAPVFVPSQKRYTAHEQSEFETTV 109
            ::.|:       |.|:||:                 :.|.|.:|.| |..:....|..:   :|:
pombe   120 SVASKQMGANQISPSLSSKTMKNPADKANNTTATDVRGNTATSPYF-PFSRSPGRHSGN---STI 180

  Fly   110 D-----PEAVMEAQAGASYDTLAPGVSWAEVVGGPSSLN 143
            :     |..:.......|.|......|     |.|||||
pombe   181 NGMMTTPNFLSSGVNSRSVDEFNNSSS-----GFPSSLN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 10/22 (45%)
RING 213..267 CDD:238093
SPCC1739.01NP_588409.2 ZnF_C3H1 43..67 CDD:214632 1/10 (10%)
ZnF_C3H1 72..92 CDD:214632 8/19 (42%)
YTH1 86..379 CDD:227416 29/139 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.