DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and AgaP_AGAP011657

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_320854.3 Gene:AgaP_AGAP011657 / 1280980 VectorBaseID:AGAP011657 Length:167 Species:Anopheles gambiae


Alignment Length:155 Identity:62/155 - (40%)
Similarity:88/155 - (56%) Gaps:5/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 CEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEK-AGREKRFG 232
            |::||::||...|..|.|.|...|:....|.::..|    |:.|||.||.:.::|| ...|:|||
Mosquito     7 CDLCDKFCLALGDNDQNRRHKASCISAQVQEIDKVF----SRKKTCAICLEVVLEKNPPAERRFG 67

  Fly   233 ILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAAL 297
            |||.|.|.||:.||:|||...::...:.:.||.|||.|.|..|...|.|.:.||.:....||:.|
Mosquito    68 ILPKCKHTFCVSCIKTWRSTTEYPETLRKGCPICRVHSSFFFPCKVWAEDEREKKRQYAIYRSIL 132

  Fly   298 GAKDCKYFKKGEGKCPFGNKCFYKH 322
            ...|||.:.:|.|.||||.:|.::|
Mosquito   133 KKIDCKRYNQGAGACPFGERCHFRH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632
RING 213..267 CDD:238093 24/54 (44%)
AgaP_AGAP011657XP_320854.3 RING 47..102 CDD:238093 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.