DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkrn1 and TMC6

DIOPT Version :9

Sequence 1:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001120670.1 Gene:TMC6 / 11322 HGNCID:18021 Length:805 Species:Homo sapiens


Alignment Length:146 Identity:41/146 - (28%)
Similarity:62/146 - (42%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPECEEQVATDVLPKPSTSSSSTIG-SRSASISS------QQRNWANAPV---FV----PSQKRY 97
            |||..:..||  |...::..|.||| ||.|.||.      |.|..::.|:   ||    ||.:.|
Human    69 RPEGTQSTAT--LRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRPLLGNFVRSAWPSLRLY 131

  Fly    98 ------TAHEQSEFETTVDPEAVMEAQAGASYDTLAPGVSWAEVVGGPSSLNKEDYGEENSSCAW 156
                  ||.|:.|.::.:..|  :::.|.|..|.:..|:        |.||.::....|.|....
Human   132 DLELDPTALEEEEKQSLLVKE--LQSLAVAQRDHMLRGM--------PLSLAEKRSLREKSRTPR 186

  Fly   157 GEFSAYPIHMELCEMC 172
            |::...|....:|..|
Human   187 GKWRGQPGSGGVCSCC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632
RING 213..267 CDD:238093
TMC6NP_001120670.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
TMC 540..646 CDD:400250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..805
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.