DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and IGFN1

DIOPT Version :9

Sequence 1:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001158058.1 Gene:IGFN1 / 91156 HGNCID:24607 Length:3708 Species:Homo sapiens


Alignment Length:986 Identity:200/986 - (20%)
Similarity:326/986 - (33%) Gaps:302/986 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEE 159
            |.:.:.|. :.::||....:.|:    |..|:.:..|.       .|.....:|.   |.:||:.
Human  2877 DGRLDIYG-ERRDATRSSTSRYK----PGTGSFSKDAQ-------GPMGHFSQGL---ADMEVQP 2926

  Fly   160 RQNLTLHC-IAENANPAAEIVWFQGEVPVSTAP--------------IVTVNQTAPKRFT----- 204
            .:..||.| :..:..|.   .||:..|.::|..              |..|..|...|:|     
Human  2927 GEAATLSCTLTSDLGPG---TWFKDGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGD 2988

  Fly   205 --TSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQ 267
              :.:||.:|.              ...:.|||..:.:..|.|  ..|.|..             
Human  2989 QQSEATLTVQD--------------SPTIAPDVTEKLREPLVV--KAGKPVI------------- 3024

  Fly   268 EVQIACRSRGGNPPAQLTWYRNGV-AISSPQR----------------TSGRLSENVYKFTAAAE 315
             |:|..:|   :.|.|..|.::|. .:.|..|                ::||.....|..|..:|
Human  3025 -VKIPFQS---HLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSE 3085

  Fly   316 DNGANLVCEAKNLLATTPLRAELNLTVLYAP---------KDVYLSGA------NQAKVGDSVQL 365
            ...               ::|||.|.|:..|         :|.:.:|.      .:...|.:|: 
Human  3086 GGS---------------VQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVE- 3134

  Fly   366 SCVTAPSNPQARISW-SINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTE 429
             |.........|.:| .:...|.|::|:.......|                |.:.....|:.:|
Human  3135 -CYVVERRQAGRSTWLKVGEAPADSTTFTDAHVEPG----------------RKYTFRVRAVTSE 3182

  Fly   430 LTQNVVGSHTVNVL------YPPSPPLLTGYNDGDILI--------SGSIL--KLQCSSAGGN-- 476
            .....:.|..:.|.      .|.:|.:|:..:.|..|.        |..||  .::....|.|  
Human  3183 GAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTW 3247

  Fly   477 ------PPPTLQWYKNDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAIDIPLFATK 535
                  |.|..:|           .:.|.:             ....|:.:|...|...|     
Human  3248 TAVNDQPVPERRW-----------TVADVR-------------QGCQYEFRVTAVAPSGP----- 3283

  Fly   536 TLGVHFPPETVKIS---VVPKNLVPGIRAKLICDSSSSNPPAKISW----WKDGIPVEG--LNLA 591
              |...||.....:   :.|..||..::.     :..||....:||    .::|...:|  :.|.
Human  3284 --GEPGPPSDAVFARDPMRPPGLVRNLQV-----TDRSNTSITLSWAGPDTQEGDEAQGYVVELC 3341

  Fly   592 NRPGL-W-GGSVSTLEMYVNITQDL---DGIVYTCQSHNE--VLQRSVHETI--SLDILYPPKFE 647
            :...| | ...|.|:.:.....:.|   :|......:.||  ..|.|..:|:  ::.:...|||.
Human  3342 SSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFL 3406

  Fly   648 TPQST-TFVGVE-GAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDG-PRLNISRLS 709
            ...|| ..:.|: |....|.:.....||. ..||.|||||:...|::   :..|| .:|.|....
Human  3407 VDSSTKDLLTVKVGDTVRVPVSFEAMPMP-EVTWLKDGLPLPKRSVT---VTKDGLTQLLIPVAG 3467

  Fly   710 RNDAGVYICEALNSQGTAL---LEIQVAV-----------EYAP-TITAVSEGRSFVAGEPAVLA 759
            .:|:|:|.......||..:   ..|:||.           |..| |:||..|..   ..|...:.
Human  3468 LSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPS---PDEAQDVP 3529

  Fly   760 CHIQARPLEAAHVRWSR----------------DGYDLATRTISSFENGTALLQIASVERSDIGN 808
            .|.......:||..|..                .|::...|.::..|.|.:       :.||...
Human  3530 LHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNELGAS-------KPSDTSQ 3587

  Fly   809 FTCIVDNQRG-----APAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLI------CRSLA-- 860
            ..|| ..||.     ||..:.        |::...|.|.     :|:|:.|:      |.|.|  
Human  3588 PWCI-PRQRDRFTVKAPCYRE--------PDLSQKPRFL-----VGLRSHLLPQGCECCMSCAVQ 3638

  Fly   861 -SPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQA- 923
             ||:|...|.::.:.|      :........|.|.. .:|.|.:.||.|.|:|:.|..|:|||| 
Human  3639 GSPRPHVTWFKNDRSL------EGNPAVYSTDLLGV-CSLTIPSVSPKDSGEYKAVAENTLGQAV 3696

  Fly   924 -STTLEFSKPS 933
             :.||...:||
Human  3697 STATLIVIEPS 3707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_001286439.1 Ig 44..122 CDD:299845 5/26 (19%)
IG_like 45..137 CDD:214653 8/41 (20%)
Ig 153..231 CDD:299845 19/99 (19%)
IG_like 258..342 CDD:214653 18/100 (18%)
Ig 266..327 CDD:299845 14/77 (18%)
IG_like 357..>414 CDD:214653 9/57 (16%)
Ig 360..427 CDD:299845 11/67 (16%)
Ig <468..526 CDD:299845 8/65 (12%)
I-set 547..633 CDD:254352 20/101 (20%)
Ig 556..631 CDD:299845 17/87 (20%)
I-set 644..735 CDD:254352 29/96 (30%)
IGc2 668..725 CDD:197706 17/57 (30%)
IG_like 751..829 CDD:214653 17/98 (17%)
IGc2 753..815 CDD:197706 13/77 (17%)
Ig 852..928 CDD:143165 25/86 (29%)
FN3 935..1017 CDD:238020
IGFN1NP_001158058.1 I-set 29..120 CDD:254352
Ig 46..120 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..81
I-set 309..395 CDD:254352
I-set 2914..2997 CDD:254352 19/88 (22%)
Ig 2930..2998 CDD:143165 15/70 (21%)
I-set 3005..3097 CDD:254352 25/125 (20%)
Ig 3017..3104 CDD:299845 23/120 (19%)
FN3 3101..3193 CDD:238020 16/109 (15%)
FN3 3201..3278 CDD:238020 16/100 (16%)
FN3 3302..3388 CDD:238020 18/90 (20%)
IG_like 3415..3494 CDD:214653 23/82 (28%)
Ig 3422..3494 CDD:299845 21/75 (28%)
FN3 3498..3587 CDD:238020 17/98 (17%)
I-set 3614..3703 CDD:254352 30/100 (30%)
Ig 3633..3700 CDD:143165 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.