DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and HMCN1

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_114141.2 Gene:HMCN1 / 83872 HGNCID:19194 Length:5635 Species:Homo sapiens


Alignment Length:1024 Identity:252/1024 - (24%)
Similarity:405/1024 - (39%) Gaps:159/1024 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QVAAPPVQKFHLTPHDLQILEGTDTLLRCEVSNR-AGKVQWTKDGFALGFSAVIPGFPRYSVLVD 95
            ||.|||.....:...::.:|:|:.|.:.|..... |..:.|.:||..||..|.:          .
Human  3429 QVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDAHL----------T 3483

  Fly    96 AKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEER 160
            ...:...||:..|..||..:|.|.....||.  :..:..|.::..|.   |.|...:..:.|...
Human  3484 VSTHGMVLQLLKAETEDSGKYTCIASNEAGE--VSKHFILKVLEPPH---INGSEEHEEISVIVN 3543

  Fly   161 QNLTLHCIAENANPAAEIVWFQGEVPV-STAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSC 224
            ..|.|.|||... ||.::.|.:...|: .|..:.|:......|.:|:..        :|...::|
Human  3544 NPLELTCIASGI-PAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQV--------EDTGRYTC 3599

  Fly   225 EARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGE--TLHRGQEVQIACRSRGGNPPAQLTWY 287
            .|...|...|.....:|.:    ||.   ..|..:..  |:.|.::|.:.|:| ...||..:||.
Human  3600 LASSPAGDDDKEYLVRVHV----PPN---IAGTDEPRDITVLRNRQVTLECKS-DAVPPPVITWL 3656

  Fly   288 RNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLS 352
            |||..:.:..|..........:...|...:.||..|.|.|:...|  ..|..|||...|.   :.
Human  3657 RNGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKT--TREFILTVNVPPN---IK 3716

  Fly   353 GANQAKV---GDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDS 414
            |..|:.|   ..|..|.|: |...|..||:|                ..||..::.::...:|..
Human  3717 GGPQSLVILLNKSTVLECI-AEGVPTPRITW----------------RKDGAVLAGNHARYSILE 3764

  Fly   415 QSRTFIAVCHALNTE----LTQNVVGSH----TVNVLYPPSPPLLTGYNDGDILISGSILKLQCS 471
            .....|...|..:|.    :..|..|:.    .:.|..|||  :..|..:..::::.. ..|.| 
Human  3765 NGFLHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPS--IAPGPTNMTVIVNVQ-TTLAC- 3825

  Fly   472 SAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLLV--NASDNNAIYKCKVQNAAIDIPLFAT 534
            .|.|.|.|::.|.||..::|........::.|..||::  .:.|:.|.|:|.|.|.|.|..  .|
Human  3826 EATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDK--RT 3888

  Fly   535 KTLGVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPP-AKISWWKDGIPV----EGLNLANRP 594
            ..|.|..||   .|:..|.:.:....|..:...::|..| ..|.|.|:||.:    :|..:    
Human  3889 VDLTVQVPP---SIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRI---- 3946

  Fly   595 GLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEG 659
             |..|::..|...:|....     |||.:.|..  .|.|..::|.:..||..: ||.:....:..
Human  3947 -LSSGAIEILATQLNHAGR-----YTCVARNAA--GSAHRHVTLHVHEPPVIQ-PQPSELHVILN 4002

  Fly   660 APFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQ 724
            .|..:...|:|.|... .||.|:|:.::::..:...|.|.|  |.|||..|.|||.|:|.|.|..
Human  4003 NPILLPCEATGTPSPF-ITWQKEGINVNTSGRNHAVLPSGG--LQISRAVREDAGTYMCVAQNPA 4064

  Fly   725 GTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDG----YDLATRT 785
            ||||.:|::.|:..|.|:...:.......:|..|:|  :|..|....:.|.:||    ..:..|.
Human  4065 GTALGKIKLNVQVPPVISPHLKEYVIAVDKPITLSC--EADGLPPPDITWHKDGRAIVESIRQRV 4127

  Fly   786 ISSFENGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGV 850
            :||     ..||||.|:..|.|::||:..|..|: ::.:..|.|...|.|..:.|  .|......
Human  4128 LSS-----GSLQIAFVQPGDAGHYTCMAANVAGS-SSTSTKLTVHVPPRIRSTEG--HYTVNENS 4184

  Fly   851 RAQLICRSLASPQPSFIWRRHGKD--LKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYE 913
            :|.|.|.:...|.|:..|:   ||  |......|:.:..        ...|::||...:|.|.|.
Human  4185 QAILPCVADGIPTPAINWK---KDNVLLANLLGKYTAEP--------YGELILENVVLEDSGFYT 4238

  Fly   914 CVVRNSLGQASTTLEFSKPSRP-------DAPL----QLRVGNVSDTGV---DLNWTPGFDGGMQ 964
            ||..|:.|:.:.|:..:....|       |..|    |||: :...||:   .|.||  |:..: 
Human  4239 CVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRL-SCKATGIPLPKLTWT--FNNNI- 4299

  Fly   965 TYFRLRLKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAG 1013
                  :..|       .|:..||..:.::.:....:..:...|.|..|
Human  4300 ------IPAH-------FDSVNGHSELVIERVSKEDSGTYVCTAENSVG 4335

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 21/92 (23%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 91..105 CDD:409353 1/13 (8%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 17/70 (24%)
Ig strand B 162..167 CDD:409353 2/4 (50%)
Ig strand C 177..181 CDD:409353 0/3 (0%)
Ig strand E 207..211 CDD:409353 0/3 (0%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 25/97 (26%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 1/3 (33%)
Ig strand F 320..325 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 18/94 (19%)
Ig strand B 363..367 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 2/3 (67%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 1/4 (25%)
Ig 443..527 CDD:472250 23/85 (27%)
Ig strand B 466..470 CDD:409353 1/3 (33%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 1/3 (33%)
Ig strand F 517..522 CDD:409353 2/4 (50%)
Ig 554..640 CDD:472250 20/90 (22%)
Ig strand B 561..565 CDD:409353 1/3 (33%)
Ig strand C 575..579 CDD:409353 1/3 (33%)
Ig strand E 602..608 CDD:409353 1/5 (20%)
Ig strand F 618..623 CDD:409353 3/4 (75%)
Ig strand G 633..636 CDD:409353 1/2 (50%)
Ig_3 643..722 CDD:464046 26/78 (33%)
Ig 748..829 CDD:472250 23/84 (27%)
Ig strand B 756..760 CDD:409353 1/3 (33%)
Ig strand C 769..775 CDD:409353 0/5 (0%)
Ig strand E 792..798 CDD:409353 1/5 (20%)
Ig strand F 808..813 CDD:409353 2/4 (50%)
Ig strand G 822..825 CDD:409353 0/2 (0%)
Ig_3 833..918 CDD:464046 22/86 (26%)
FN3 <932..1151 CDD:442628 19/96 (20%)
FN3 935..1017 CDD:238020 19/93 (20%)
HMCN1NP_114141.2 ChlD <12..210 CDD:440853
Ig 448..513 CDD:409353
Ig strand B 448..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 482..486 CDD:409353
Ig strand F 496..501 CDD:409353
Ig strand G 510..513 CDD:409353
IG_like 526..608 CDD:214653
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
Ig strand G 601..604 CDD:409353
I-set 612..696 CDD:400151
Ig strand B 629..633 CDD:409353
Ig strand C 642..646 CDD:409353
Ig strand E 664..668 CDD:409353
Ig strand F 678..683 CDD:409353
Ig strand G 691..694 CDD:409353
Ig 713..789 CDD:472250
Ig strand B 720..723 CDD:409353
Ig strand C 732..736 CDD:409353
Ig strand E 755..759 CDD:409353
Ig strand F 769..774 CDD:409353
Ig strand G 783..786 CDD:409353
Ig 793..884 CDD:472250
Ig strand B 810..814 CDD:409353
Ig strand C 823..829 CDD:409353
Ig strand E 850..854 CDD:409353
Ig strand F 864..869 CDD:409353
Ig strand G 877..880 CDD:409353
Ig 890..977 CDD:472250
Ig strand B 907..911 CDD:409353
Ig strand C 921..925 CDD:409353
Ig strand E 943..947 CDD:409353
Ig strand F 957..962 CDD:409353
Ig 980..1071 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1011..1015 CDD:409353
Ig strand E 1035..1038 CDD:409353
Ig strand F 1048..1053 CDD:409353
Ig strand G 1061..1064 CDD:409353
IG_like 1086..1167 CDD:214653
Ig strand B 1097..1101 CDD:409353
Ig strand C 1110..1114 CDD:409353
Ig strand E 1134..1137 CDD:409353
Ig strand F 1147..1152 CDD:409353
Ig strand G 1160..1163 CDD:409353
I-set 1171..1258 CDD:400151
Ig strand B 1188..1192 CDD:409353
Ig strand C 1201..1205 CDD:409353
Ig strand E 1224..1228 CDD:409353
Ig strand F 1238..1243 CDD:409353
Ig strand G 1251..1254 CDD:409353
Ig 1262..1355 CDD:472250
Ig strand B 1284..1288 CDD:409353
Ig strand C 1297..1301 CDD:409353
Ig strand E 1320..1324 CDD:409353
Ig strand F 1335..1340 CDD:409353
Ig strand G 1348..1351 CDD:409353
Ig 1369..1442 CDD:472250
Ig strand C 1391..1395 CDD:409353
Ig strand E 1414..1418 CDD:409353
Ig strand F 1428..1433 CDD:409353
Ig strand G 1441..1444 CDD:409353
Ig_3 1451..1529 CDD:464046
I-set 1556..1635 CDD:400151
Ig strand B 1565..1569 CDD:409353
Ig strand C 1578..1582 CDD:409353
Ig strand E 1601..1605 CDD:409353
Ig strand F 1615..1620 CDD:409353
Ig strand G 1628..1631 CDD:409353
Ig 1648..1725 CDD:472250
Ig strand B 1659..1663 CDD:409353
Ig strand C 1672..1676 CDD:409353
Ig strand E 1695..1699 CDD:409353
Ig strand F 1709..1714 CDD:409353
Ig 1746..1822 CDD:472250
Ig strand B 1752..1756 CDD:409353
Ig strand C 1765..1769 CDD:409353
Ig strand E 1788..1792 CDD:409353
Ig strand F 1802..1807 CDD:409353
Ig 1828..1905 CDD:472250
Ig strand B 1844..1848 CDD:409353
Ig strand C 1857..1861 CDD:409353
Ig strand E 1881..1885 CDD:409353
Ig strand F 1895..1900 CDD:409353
Ig 1928..2000 CDD:472250
Ig strand B 1938..1942 CDD:409353
Ig strand C 1951..1955 CDD:409353
Ig strand E 1973..1978 CDD:409353
Ig strand F 1988..1993 CDD:409353
Ig 2031..2092 CDD:472250
Ig strand C 2042..2046 CDD:409353
Ig strand E 2065..2070 CDD:409353
Ig strand F 2080..2085 CDD:409353
Ig_3 2103..2178 CDD:464046
Ig 2203..2286 CDD:472250
Ig strand C 2227..2231 CDD:409353
Ig strand E 2251..2256 CDD:409353
Ig strand F 2266..2271 CDD:409353
Ig_3 2289..2367 CDD:464046
I-set 2391..2474 CDD:400151
Ig strand B 2404..2408 CDD:409353
Ig strand C 2417..2421 CDD:409353
Ig strand E 2440..2444 CDD:409353
Ig strand F 2454..2459 CDD:409353
I-set 2478..2567 CDD:400151
Ig strand B 2497..2501 CDD:409353
Ig strand C 2510..2514 CDD:409353
Ig strand E 2533..2537 CDD:409353
Ig strand F 2547..2552 CDD:409353
I-set 2582..2663 CDD:400151
Ig strand B 2593..2597 CDD:409353
Ig strand C 2606..2610 CDD:409353
Ig strand E 2629..2633 CDD:409353
Ig strand F 2643..2648 CDD:409353
Ig strand G 2656..2659 CDD:409353
I-set 2681..2762 CDD:400151
Ig strand B 2692..2696 CDD:409353
Ig strand C 2705..2709 CDD:409353
Ig strand E 2727..2732 CDD:409353
Ig strand F 2742..2747 CDD:409353
I-set 2789..2858 CDD:400151
Ig strand B 2795..2799 CDD:409353
Ig strand C 2808..2812 CDD:409353
Ig strand E 2831..2835 CDD:409353
Ig strand F 2845..2850 CDD:409353
I-set 2879..2960 CDD:400151
Ig strand B 2890..2894 CDD:409353
Ig strand C 2903..2907 CDD:409353
Ig strand E 2926..2930 CDD:409353
Ig strand F 2940..2945 CDD:409353
I-set 2970..3052 CDD:400151
Ig strand B 2982..2986 CDD:409353
Ig strand C 2995..2999 CDD:409353
Ig strand E 3018..3022 CDD:409353
Ig strand F 3032..3037 CDD:409353
Ig strand G 3045..3048 CDD:409353
I-set 3066..3147 CDD:400151
Ig strand B 3077..3081 CDD:409353
Ig strand C 3090..3094 CDD:409353
Ig strand E 3111..3117 CDD:409353
Ig strand F 3127..3132 CDD:409353
Ig strand G 3140..3143 CDD:409353
Ig_3 3150..3228 CDD:464046
I-set 3252..3336 CDD:400151
Ig strand B 3264..3268 CDD:409353
Ig strand C 3277..3281 CDD:409353
Ig strand E 3302..3306 CDD:409353
Ig strand F 3316..3321 CDD:409353
Ig strand G 3329..3332 CDD:409353