DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Nectin3

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_067470.1 Gene:Nectin3 / 58998 MGIID:1930171 Length:549 Species:Mus musculus


Alignment Length:605 Identity:125/605 - (20%)
Similarity:207/605 - (34%) Gaps:188/605 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 GSHTVNVLYPPS----------PPLLTGYNDGDILISGSILKLQCSSAGGN----PPPTLQWYK- 485
            |...::..:||:          ||||.      :||...:....|.:..|:    |..|..|.| 
Mouse    15 GKAQLSSAFPPAAGLLLPAPTPPPLLL------LLIPLLLFSRLCGALAGSIIVEPHVTAVWGKN 73

  Fly   486 ---------NDKIINAPSKLVDSKITSELS------------------LLVNASDNNAI------ 517
                     |:.|.....:.:..|.|..::                  |..|.|.|:|.      
Mouse    74 VSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDYQGRVLFKNYSLNDATITLHNI 138

  Fly   518 -------YKCKVQNAAIDIPL---FATKTLGVHFPPETVKISVVPKNLVPGIRAKL--ICDSSSS 570
                   |.||    |:..||   .::.|:.|...| ||.:...|.:|:.|....:  :|.:::.
Mouse   139 GFSDSGKYICK----AVTFPLGNAQSSTTVTVLVEP-TVSLIKGPDSLIDGGNETVAAVCVAATG 198

  Fly   571 NPPAKISWWKDGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHET 635
            .|.|:|.|..|...:|. :..:.|......||..:::.  |:...|...||...:..|::.:..:
Mouse   199 KPVAQIDWEGDLGEMES-STTSFPNETATIVSQYKLFP--TRFARGRRITCVVKHPALEKDIRYS 260

  Fly   636 ISLDILYPPKFETP--QSTTFVGVEGAPFHVELLASGNPMVITYTWTK------DGLPISSNSLS 692
            ..|||.|.|:....  ....|||.:|.  :::..|..||......|::      |||..|.|:|.
Mouse   261 FILDIQYAPEVSVTGYDGNWFVGRKGV--NLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLH 323

  Fly   693 GQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAV 757
                       .:..|:.|.:|||:|:..||.|....:..:.:...||.|.:         :|. 
Mouse   324 -----------FVHPLTVNYSGVYVCKVSNSLGQRSDQKVIYISDPPTTTTL---------QPT- 367

  Fly   758 LACHIQARPLEAAHVRW---SRDGYDLATR---------TISSFENGTALLQIASVERSDIGNFT 810
                          |:|   ..|..|:||.         |:::.::.|....||||    :|   
Mouse   368 --------------VQWHSSPADVQDIATEHKKLPFPLSTLATLKDDTIGTIIASV----VG--- 411

  Fly   811 CIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDL 875
                   ||     :.||:     :....|...|..|...|.....::...|.            
Mouse   412 -------GA-----LFLVL-----VSILAGVFCYRRRRTFRGDYFAKNYIPPS------------ 447

  Fly   876 KMQRRNKFKSVERQVDAL------NFESALLIENTSP------DDYGQYECVVRNSLGQASTTLE 928
            .||:       |.|:|.|      ::..::..||.:|      .||  .|...:...........
Mouse   448 DMQK-------ESQIDVLHQDELDSYPDSVKKENKNPVNNLIRKDY--LEEPEKTQWNNVENLTR 503

  Fly   929 FSKPSRPDAPLQLRVGNVSD 948
            |.:|......|::.:..|||
Mouse   504 FERPMDYYEDLKMGMKFVSD 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353
Ig 162..232 CDD:472250
Ig strand B 162..167 CDD:409353
Ig strand C 177..181 CDD:409353
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand F 320..325 CDD:409353
Ig strand G 335..338 CDD:409353
Ig 343..431 CDD:472250
Ig strand B 363..367 CDD:409353
Ig strand C 377..381 CDD:409353
Ig strand E 406..410 CDD:409353
Ig strand F 420..425 CDD:409353
Ig 443..527 CDD:472250 26/138 (19%)
Ig strand B 466..470 CDD:409353 0/3 (0%)
Ig strand C 480..484 CDD:409353 1/3 (33%)
Ig strand E 503..507 CDD:409353 0/21 (0%)
Ig strand F 517..522 CDD:409353 2/17 (12%)
Ig 554..640 CDD:472250 18/87 (21%)
Ig strand B 561..565 CDD:409353 0/5 (0%)
Ig strand C 575..579 CDD:409353 1/3 (33%)
Ig strand E 602..608 CDD:409353 1/5 (20%)
Ig strand F 618..623 CDD:409353 2/4 (50%)
Ig strand G 633..636 CDD:409353 0/2 (0%)
Ig_3 643..722 CDD:464046 21/86 (24%)
Ig 748..829 CDD:472250 17/92 (18%)
Ig strand B 756..760 CDD:409353 0/3 (0%)
Ig strand C 769..775 CDD:409353 2/8 (25%)
Ig strand E 792..798 CDD:409353 1/5 (20%)
Ig strand F 808..813 CDD:409353 0/4 (0%)
Ig strand G 822..825 CDD:409353 0/2 (0%)
Ig_3 833..918 CDD:464046 17/96 (18%)
FN3 <932..1151 CDD:442628 5/17 (29%)
FN3 935..1017 CDD:238020 4/14 (29%)
Nectin3NP_067470.1 IgV_1_Nectin-3_like 58..167 CDD:409470 21/112 (19%)
FR1 58..81 CDD:409470 5/22 (23%)
Ig strand A 58..62 CDD:409470 1/3 (33%)
Ig strand A' 64..68 CDD:409470 1/3 (33%)
Ig strand B 73..81 CDD:409470 0/7 (0%)
CDR1 82..86 CDD:409470 1/3 (33%)
FR2 87..93 CDD:409470 0/5 (0%)
Ig strand C 88..93 CDD:409470 0/4 (0%)
CDR2 94..113 CDD:409470 2/18 (11%)
Ig strand C' 103..108 CDD:409470 0/4 (0%)
Ig strand C' 110..114 CDD:409470 0/3 (0%)
FR3 114..152 CDD:409470 9/41 (22%)
Ig strand D 121..125 CDD:409470 1/3 (33%)
Ig strand E 130..137 CDD:409470 1/6 (17%)
Ig strand F 144..152 CDD:409470 4/11 (36%)
CDR3 153..156 CDD:409470 1/2 (50%)
Ig strand G 156..166 CDD:409470 1/9 (11%)
FR4 157..167 CDD:409470 1/9 (11%)
IgC1_2_Nectin-3-4_like 170..265 CDD:409501 22/98 (22%)
Ig strand A 170..176 CDD:409501 3/6 (50%)
Ig strand B 189..196 CDD:409501 1/6 (17%)
Ig strand C 201..207 CDD:409501 2/5 (40%)
Ig strand C' 209..211 CDD:409501 1/1 (100%)
Ig strand D 213..220 CDD:409501 1/7 (14%)
Ig strand E 225..233 CDD:409501 2/7 (29%)
Ig strand F 243..250 CDD:409501 2/6 (33%)
Ig strand G 256..262 CDD:409501 0/5 (0%)
Ig 269..355 CDD:472250 24/98 (24%)
Ig strand B 287..291 CDD:409353 0/5 (0%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 320..325 CDD:409353 2/15 (13%)
Ig strand F 335..340 CDD:409353 3/4 (75%)
Ig strand G 350..353 CDD:409353 0/2 (0%)
TM_EGFR-like 402..432 CDD:213052 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.