DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Nectin1

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_067399.2 Gene:Nectin1 / 58235 MGIID:1926483 Length:515 Species:Mus musculus


Alignment Length:530 Identity:105/530 - (19%)
Similarity:176/530 - (33%) Gaps:187/530 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GTDTLLRCEVSN-----RAGKVQW------TKDGFA-----LGFSAVIPGFPRYSVLVDAKQNAY 101
            |||.:|.|..:|     :..:|.|      :|...|     :|.|.:    |.|...|:..:.::
Mouse    44 GTDVVLHCSFANPLPSVKITQVTWQKASNGSKQNMAIYNPTMGVSVL----PPYEKRVEFLRPSF 104

  Fly   102 ---NLQIKNATLEDDAEYQCQVGP-AAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEERQN 162
               .:::....|||:..|.|:... ..||...:.|  |:::|.|:: .|||    .|..:..|:.
Mouse   105 IDGTIRLSGLELEDEGMYICEFATFPTGNRESQLN--LTVMAKPTN-WIEG----TRAVLRARKG 162

  Fly   163 -----LTLHCIAENANPAAEIVW---FQGEV-------PVSTAPIVTVNQTAPKRFTTSSTL--- 209
                 |...|.:.|..|.:.:.|   .:||.       |..|..:::..:..|.|.....:|   
Mouse   163 QDDKVLVATCTSANGKPPSAVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHRQSLACI 227

  Fly   210 ---HLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQI 271
               ||     |.::|                  .:.|:|.|.|... .||:.....|.| .:|::
Mouse   228 VNYHL-----DRFRE------------------SLTLNVQYEPEVT-IEGFDGNWYLQR-TDVKL 267

  Fly   272 ACRSRGGNPPA-QLTWYR-NG---VAISSPQRT---SGRLSENVYKFTAAAEDNGANLVCEAKNL 328
            .|:: ..|||| :..|.. ||   ..:.:..||   .|.::.::          ....:|||.|.
Mouse   268 TCKA-DANPPATEYHWTTLNGSLPKGVEAQNRTLFFRGPITYSL----------AGTYICEATNP 321

  Fly   329 LATTPLRAELNLTVL-YAP---------------------------------------------- 346
            :.|...:.|:|:|.. |.|                                              
Mouse   322 IGTRSGQVEVNITEFPYTPTPEHGRRAGQMPTAIIGGVAGSVLLVLIVVGGIIVALRRRRHTFKG 386

  Fly   347 -----KDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSIN------------GRPLDNSTYKT 394
                 |.||.:|.::|.:              ||.....:.|            ..||..|:|:.
Mouse   387 DYSTKKHVYGNGYSKAGI--------------PQHHPPMAQNLQYPDDSDDEKKAGPLGGSSYEE 437

  Fly   395 TSSSDGGW-----VSSSNISLTIDSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPS----PPL 450
            ....:||.     |...:.....|:: |.:..|..|   |..|:..|..|:...|.|.    ...
Mouse   438 EEEEEGGGGGERKVGGPHPKYDEDAK-RPYFTVDEA---EARQDGYGDRTLGYQYDPEQLDLAEN 498

  Fly   451 LTGYNDGDIL 460
            :...|||..:
Mouse   499 MVSQNDGSFI 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 24/103 (23%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 2/9 (22%)
Ig strand E 91..105 CDD:409353 1/16 (6%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 16/90 (18%)
Ig strand B 162..167 CDD:409353 1/9 (11%)
Ig strand C 177..181 CDD:409353 1/6 (17%)
Ig strand E 207..211 CDD:409353 1/9 (11%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 25/103 (24%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 22/156 (14%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 1/4 (25%)
Ig 443..527 CDD:472250 5/22 (23%)
Ig strand B 466..470 CDD:409353
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
Nectin1NP_067399.2 IgV_1_Nectin-1_like 31..143 CDD:409469 24/104 (23%)
FR1 31..54 CDD:409469 5/9 (56%)
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469
Ig strand B 46..54 CDD:409469 3/7 (43%)
CDR1 55..62 CDD:409469 1/6 (17%)
FR2 63..69 CDD:409469 2/5 (40%)
Ig strand C 64..69 CDD:409469 2/4 (50%)
CDR2 70..89 CDD:409469 3/18 (17%)
Ig strand C' 79..84 CDD:409469 1/4 (25%)
Ig strand C' 86..90 CDD:409469 2/3 (67%)
FR3 90..128 CDD:409469 8/41 (20%)
Ig strand D 97..101 CDD:409469 1/3 (33%)
Ig strand E 106..113 CDD:409469 0/6 (0%)
Ig strand F 120..128 CDD:409469 2/7 (29%)
CDR3 129..132 CDD:409469 0/2 (0%)
Ig strand G 132..142 CDD:409469 4/11 (36%)
FR4 133..143 CDD:409469 3/11 (27%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 23/124 (19%)
Ig strand A 146..152 CDD:143298 2/6 (33%)
Ig strand B 168..175 CDD:143298 2/6 (33%)
Ig strand C 180..186 CDD:143298 0/5 (0%)
Ig strand C' 188..190 CDD:143298 0/1 (0%)
Ig strand D 191..199 CDD:143298 2/7 (29%)
Ig strand E 205..213 CDD:143298 0/7 (0%)
Ig strand F 223..230 CDD:143298 1/6 (17%)
Ig strand G 234..240 CDD:143298 1/23 (4%)
Ig 247..333 CDD:472250 23/98 (23%)
Ig strand B 265..269 CDD:409524 1/3 (33%)
Ig strand C 279..283 CDD:409524 0/3 (0%)
Interaction with FGFR. /evidence=ECO:0000269|PubMed:22955284 282..299 3/16 (19%)
Ig strand E 298..302 CDD:409524 2/3 (67%)
Ig strand F 313..318 CDD:409524 1/4 (25%)
Ig strand G 330..333 CDD:409524 1/2 (50%)
TM_EGFR-like 353..382 CDD:213052 0/28 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..486 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.