DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and kirrel3b

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_021323594.1 Gene:kirrel3b / 572369 ZFINID:ZDB-GENE-100713-3 Length:795 Species:Danio rerio


Alignment Length:969 Identity:206/969 - (21%)
Similarity:340/969 - (35%) Gaps:274/969 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQI 105
            |...|.||.::.|....|.|.:....|.|.|.:||.|||....:.|:|||:|:.|.....::|:|
Zfish    31 FSQQPQDLVVVAGQPVTLPCSIPGYHGVVLWLRDGLALGVGRDLSGYPRYAVVGDHGSGEHHLRI 95

  Fly   106 KNATLEDDAEYQCQVGPAAGNPAIRAN-AKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHCIA 169
            :...|.|||.::||    |...|:|:. |:|:::..|...:|.|   ...|.:.....|.|.|.|
Zfish    96 QKVELMDDAVFECQ----AIQAAMRSRPARLTVLVPPDDPMITG---GPVVSLRAGDPLNLTCHA 153

  Fly   170 ENANPAAEIVWFQ-GEVPVSTAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPP 233
            :||.|||.|:|.: |||........|:.:.. :|.:|.|||::.....:..::..|.|.:||:|.
Zfish   154 DNAKPAASIIWIRNGEVLNGAMYSKTLLRDG-RRESTVSTLYISASNIESGQKIICRASNKAVPN 217

  Fly   234 --------DVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNG 290
                    |:.....|.|||             :.:.:..|..|:..|.::...|..|..|.:.|
Zfish   218 GKETSVTIDIQHLPLVNLSV-------------EPQPVLEGNLVKFHCSAKANPPVTQYKWAKGG 269

  Fly   291 VAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN 355
            ..|   :..||...|.:...:...|.    :.||..|.|.:|.:  ..|:.|.:.|:......:.
Zfish   270 SVI---KEVSGDTYEVIVDHSFFTEP----VSCEVTNPLGSTNI--SRNVDVYFGPRMAAEPQSL 325

  Fly   356 QAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFI 420
            |..:|.....:|... .||...|.|...|              .|..:|:.|| ||:.|      
Zfish   326 QVDLGSDAVFNCAWT-GNPSLTIVWMKRG--------------SGVVLSNENI-LTLKS------ 368

  Fly   421 AVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYK 485
                     :.|...|.:....:.|.                                       
Zfish   369 ---------VRQEDAGKYVCRAVVPR--------------------------------------- 385

  Fly   486 NDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVHFPPETVKISV 550
                :.|..|        |:||.||.                              ||   .||.
Zfish   386 ----VGAAEK--------EVSLTVNG------------------------------PP---TISS 405

  Fly   551 VPKNLVP-GIRAKLICDSSSSNPPAKISW-WKDGIPVEGLN---LANRPGLWGGSVSTLEMYVNI 610
            ...:..| |.:.::.|...|:.||.:|:| ||:.:...|.:   .........|.:|||.|...:
Zfish   406 TQTHQAPHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIV 470

  Fly   611 TQDLDGIVYTCQSHN------EVL----QRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVE 665
            ..|.. .:|.|.:.|      |::    |....:::.:.::             :||....|...
Zfish   471 PADFQ-TIYNCTAWNSFGSDTEIIRLKEQGGSQDSLPVAVI-------------IGVAVGAFVAF 521

  Fly   666 LLASGNPMVITYT----------WTKDG---LPISSNSLSGQR--LISDGPRLNISRL--SRNDA 713
            ::..|.......|          .|:|.   :|....|:..|:  |.|.....|:..:  ::||.
Zfish   522 IVLMGTIGAFCCTRSQRKKSAHLCTEDAHLVMPTLPTSICAQQRELASKIKTENLKGVVSAKNDI 586

  Fly   714 GVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSF----VAGEPAVLACHIQARPLEAAHVRW 774
            .|   |.::....|..|.:   |::.....:.|...|    |..:..||    |....|..|::.
Zfish   587 RV---EIVHKDHNAARESE---EHSGMKQLMIERGEFQQESVLKQLEVL----QEEEKEYQHIKD 641

  Fly   775 SRDGYDLATRTISSFE--NGT----ALLQIASVERSDIGNFTCIVDNQRGAPAAQ---NVLLVVQ 830
            ..:||    .::::|:  :||    |..|...:.|...   |.....|| .|...   |:...:.
Zfish   642 PTNGY----YSVNTFKEHHGTPTTMAGNQTTELRRDPA---TATTGKQR-VPTGMSFTNIYSTLG 698

  Fly   831 TAPE--IDHSPGFTRYAARLGVRAQLIC-----RSLASPQPSFIWRRHGKDLKMQRRNKFKSVER 888
            ..|.  .|:|   .|:...:|..:..:|     |...|...||        |..|..:...|..:
Zfish   699 AGPNRLYDYS---QRFVLGMGSSSIELCEREFQRGSMSDSSSF--------LDTQCDSSVSSYSK 752

  Fly   889 QVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDA----PLQLRV 943
            |                 |.|.|::   ::|...||::..:|:.|..::    |||.|:
Zfish   753 Q-----------------DGYVQFD---KDSKASASSSSHYSQSSSQNSDLTRPLQKRM 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 33/92 (36%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/13 (23%)
Ig strand F 115..120 CDD:409353 1/4 (25%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig 162..232 CDD:472250 24/70 (34%)
Ig strand B 162..167 CDD:409353 2/4 (50%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 3/3 (100%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 18/95 (19%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 1/3 (33%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 16/87 (18%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 406..410 CDD:409353 2/3 (67%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 8/83 (10%)
Ig strand B 466..470 CDD:409353 0/3 (0%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 1/3 (33%)
Ig strand F 517..522 CDD:409353 0/4 (0%)
Ig 554..640 CDD:472250 22/100 (22%)
Ig strand B 561..565 CDD:409353 0/3 (0%)
Ig strand C 575..579 CDD:409353 2/4 (50%)
Ig strand E 602..608 CDD:409353 4/5 (80%)
Ig strand F 618..623 CDD:409353 2/4 (50%)
Ig strand G 633..636 CDD:409353 0/2 (0%)
Ig_3 643..722 CDD:464046 17/95 (18%)
Ig 748..829 CDD:472250 20/93 (22%)
Ig strand B 756..760 CDD:409353 2/3 (67%)
Ig strand C 769..775 CDD:409353 1/5 (20%)
Ig strand E 792..798 CDD:409353 3/9 (33%)
Ig strand F 808..813 CDD:409353 1/4 (25%)
Ig strand G 822..825 CDD:409353 0/5 (0%)
Ig_3 833..918 CDD:464046 17/91 (19%)
FN3 <932..1151 CDD:442628 5/16 (31%)
FN3 935..1017 CDD:238020 4/13 (31%)
kirrel3bXP_021323594.1 IG_like 35..124 CDD:214653 33/92 (36%)
Ig strand B 46..50 CDD:409389 1/3 (33%)
Ig strand C 58..62 CDD:409389 1/3 (33%)
Ig strand E 87..95 CDD:409389 1/7 (14%)
Ig strand F 105..110 CDD:409389 2/8 (25%)
Ig strand G 117..120 CDD:409389 0/2 (0%)
IgI_2_KIRREL3-like 130..227 CDD:409416 28/100 (28%)
Ig strand A 131..134 CDD:409416 0/2 (0%)
Ig strand A' 137..141 CDD:409416 1/3 (33%)
Ig strand B 148..155 CDD:409416 3/6 (50%)
Ig strand C 160..165 CDD:409416 2/4 (50%)
Ig strand C' 168..170 CDD:409416 1/1 (100%)
Ig strand D 173..180 CDD:409416 0/6 (0%)
Ig strand E 187..195 CDD:409416 4/7 (57%)
Ig strand F 204..212 CDD:409416 2/7 (29%)
Ig strand G 218..224 CDD:409416 0/5 (0%)
Ig_2 235..312 CDD:464026 21/98 (21%)
Ig 316..397 CDD:472250 24/162 (15%)
Ig strand B 333..337 CDD:409549 0/3 (0%)
Ig strand C 346..350 CDD:409549 1/3 (33%)
Ig strand E 362..366 CDD:409549 3/4 (75%)
IgI_5_KIRREL3 399..496 CDD:409479 25/130 (19%)
Ig strand A 400..404 CDD:409479 2/6 (33%)
Ig strand A' 406..409 CDD:409479 0/2 (0%)
Ig strand B 417..424 CDD:409479 1/6 (17%)
Ig strand C 431..436 CDD:409479 2/4 (50%)
Ig strand C' 438..441 CDD:409479 0/2 (0%)
Ig strand D 449..456 CDD:409479 0/6 (0%)
Ig strand E 459..466 CDD:409479 4/6 (67%)
Ig strand F 477..484 CDD:409479 2/6 (33%)
Ig strand G 487..494 CDD:409479 1/6 (17%)

Return to query results.
Submit another query.