DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and F11R

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:348 Identity:76/348 - (21%)
Similarity:119/348 - (34%) Gaps:87/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LATTICHV-MAAVTAPTPAAQVAAPPVQKFHLTPHDLQILEGTDTLLRCEVSN-RAGKVQWTKDG 75
            ||..:|.: :.:||.               |.:..:::|.|.....|.|..|. .:.:|:|..| 
Human    17 LAILLCSLALGSVTV---------------HSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFD- 65

  Fly    76 FALGFSAVIPGFPRYSVLVDAKQNA----------YNLQIKNATLEDDAEYQCQVGPAAGNPAIR 130
                     .|.....|..:.|..|          ..:..|:.|.||...|.|.|....||....
Human    66 ---------QGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGE 121

  Fly   131 ANAKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTV 195
            ...||.::..||...:     |............|.|..::.:|.:|..||:..:.:.|.|..| 
Human   122 VKVKLIVLVPPSKPTV-----NIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST- 180

  Fly   196 NQTAPKRFTTSS--------TLHLQPRAEDDYKEFSCEARH-------------KALPPDVPMRA 239
                 :.|:.||        .|...|.:..|..|:|||||:             :|:..:|.:..
Human   181 -----RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV 240

  Fly   240 QVQLSVLYPPGAPFFE---GYSQGETLHRG------QEVQIACRSRGGNPPAQLTWYRNG----- 290
            ...|..|...|...|.   .||:|.....|      ....:.|.:...:|.:.|:..:.|     
Human   241 AAVLVTLILLGILVFGIWFAYSRGHFDKLGACPSIFPSHAVFCPADTHDPISSLSGTKKGTSSKK 305

  Fly   291 VAISSPQRTSGRLSENVYKFTAA 313
            |..|.|   |.| ||..:|.|::
Human   306 VIYSQP---SAR-SEGEFKQTSS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 23/102 (23%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/23 (13%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 22/90 (24%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 2/11 (18%)
Ig strand F 221..226 CDD:409353 3/4 (75%)
Ig 246..342 CDD:472250 20/82 (24%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 283..287 CDD:409353 1/3 (33%)
Ig strand F 320..325 CDD:409353
Ig strand G 335..338 CDD:409353
Ig 343..431 CDD:472250
Ig strand B 363..367 CDD:409353
Ig strand C 377..381 CDD:409353
Ig strand E 406..410 CDD:409353
Ig strand F 420..425 CDD:409353
Ig 443..527 CDD:472250
Ig strand B 466..470 CDD:409353
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 25/123 (20%)
FR1 30..52 CDD:409538 6/36 (17%)
Ig strand A 30..33 CDD:409538 1/17 (6%)
Ig strand A' 37..41 CDD:409538 0/3 (0%)
Ig strand B 44..53 CDD:409538 2/8 (25%)
CDR1 53..58 CDD:409538 1/4 (25%)
Ig strand C 58..66 CDD:409538 3/17 (18%)
FR2 59..66 CDD:409538 3/16 (19%)
CDR2 69..83 CDD:409538 3/13 (23%)
Ig strand C' 69..74 CDD:409538 0/4 (0%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 6/27 (22%)
Ig strand D 86..90 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 0/3 (0%)
Ig strand F 105..113 CDD:409538 3/7 (43%)
CDR3 113..119 CDD:409538 2/5 (40%)
Ig strand G 119..128 CDD:409538 2/8 (25%)
FR4 120..129 CDD:409538 2/8 (25%)
IgI_2_JAM1 135..231 CDD:409542 22/106 (21%)
Ig strand A 135..139 CDD:409542 0/8 (0%)
Ig strand A' 141..144 CDD:409542 0/2 (0%)
Ig strand B 147..155 CDD:409542 2/7 (29%)
Ig strand C 163..168 CDD:409542 2/4 (50%)
Ig strand C' 170..172 CDD:409542 0/1 (0%)
Ig strand D 187..191 CDD:409542 1/3 (33%)
Ig strand E 195..199 CDD:409542 1/3 (33%)
Ig strand F 208..214 CDD:409542 3/5 (60%)
Ig strand G 221..231 CDD:409542 0/9 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.