DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and cadm2

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_031751706.1 Gene:cadm2 / 448238 XenbaseID:XB-GENE-998536 Length:441 Species:Xenopus tropicalis


Alignment Length:435 Identity:102/435 - (23%)
Similarity:168/435 - (38%) Gaps:70/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QVAAP----PVQ-KFHLTPHDLQILEGTDTLLRCEV-SNRAGKVQWTK---------DGFALGFS 81
            |.|:|    |.| :|.:| .::.::||....|.|.| .|....:||:.         |..||..:
 Frog    20 QAASPRNKKPSQGQFPVT-QNVTVVEGGTINLTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDN 83

  Fly    82 AVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI 146
            .:        .||.|..:..::.|.:.:|.|:.:|.|.:...   |...:.|.|.::..|.:..|
 Frog    84 RI--------ELVRASWHELSISISDVSLSDEGQYTCSLFTM---PVKTSKAYLMVLGVPENPHI 137

  Fly   147 EGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQTAPKRFTTSSTLHL 211
            .|:..    .|.|...:.|.|.:..:.|||:|.||:.:..::....:....:..|.||.:|:|..
 Frog   138 SGFTS----PVMEGDTIQLTCKSSGSKPAADIRWFKNDQEITDVQKIQQQDSNGKTFTVTSSLVF 198

  Fly   212 QPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSR 276
            |...:||.....|...|::| ...|..|:..|.:.|.|...........:   .||.:.:.|.|:
 Frog   199 QGDRKDDGAVIRCRVDHESL-TSTPQIAKQVLEIHYTPTVRILPSTPLPQ---EGQPLILICESK 259

  Fly   277 GGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLT 341
            |...|..:.|.::|..:..|:|.:....|....|.... ||| ...|||.|.:..:  .||..|.
 Frog   260 GKPLPEPVLWTKDGGELPDPERMTVNGRELTISFLNKT-DNG-TYRCEATNSIGQS--SAEYVLI 320

  Fly   342 VLYAPKDVY----LSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGW 402
            :...||.::    :.....|.|..:|.:|..|..|   |.|:...|..|   ....|..:..||.
 Frog   321 INDVPKPLFPTTIIPLFTSATVKTNVAMSTRTTKS---AFITKDPNALP---GPVATDHALIGGV 379

  Fly   403 VSSSNISLTIDSQSRTFIAVCHAL----------NTELTQNVVGS 437
            |:..           .|:.:|..:          .|.||....|:
 Frog   380 VAVV-----------VFVTLCSIILIGRYLARHKGTYLTNEAKGA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 22/101 (22%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/13 (23%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 18/69 (26%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 2/3 (67%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 24/95 (25%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 1/2 (50%)
Ig 343..431 CDD:472250 19/101 (19%)
Ig strand B 363..367 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 1/4 (25%)
Ig 443..527 CDD:472250
Ig strand B 466..470 CDD:409353
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
cadm2XP_031751706.1 IgV_1_Necl-3 34..129 CDD:409498 24/106 (23%)
Ig strand A 34..37 CDD:409498 1/2 (50%)
FR1 35..53 CDD:409498 4/18 (22%)
Ig strand A' 38..44 CDD:409498 0/5 (0%)
Ig strand B 46..54 CDD:409498 2/7 (29%)
CDR1 54..59 CDD:409498 2/4 (50%)
FR2 60..67 CDD:409498 2/6 (33%)
Ig strand C 60..66 CDD:409498 2/5 (40%)
CDR2 68..79 CDD:409498 1/10 (10%)
Ig strand C' 70..74 CDD:409498 0/3 (0%)
Ig strand C' 76..79 CDD:409498 1/2 (50%)
FR3 80..115 CDD:409498 9/42 (21%)
Ig strand D 84..91 CDD:409498 2/14 (14%)
Ig strand E 94..100 CDD:409498 0/5 (0%)
Ig strand F 107..115 CDD:409498 2/7 (29%)
CDR3 116..119 CDD:409498 0/5 (0%)
Ig strand G 119..129 CDD:409498 2/9 (22%)
FR4 121..128 CDD:409498 2/6 (33%)
IgI_2_Necl-3 128..231 CDD:409467 27/107 (25%)
Ig strand A 129..132 CDD:409467 0/2 (0%)
Ig strand A' 135..139 CDD:409467 1/3 (33%)
Ig strand B 148..158 CDD:409467 2/9 (22%)
Ig strand C 161..170 CDD:409467 6/8 (75%)
Ig strand C' 171..174 CDD:409467 0/2 (0%)
Ig strand D 176..183 CDD:409467 0/6 (0%)
Ig strand E 189..199 CDD:409467 4/9 (44%)
Ig strand F 207..215 CDD:409467 1/7 (14%)
Ig strand G 223..230 CDD:409467 1/6 (17%)
Ig_3 235..308 CDD:464046 19/77 (25%)
4.1m 394..412 CDD:128590 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.