DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and side-IV

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster


Alignment Length:861 Identity:187/861 - (21%)
Similarity:287/861 - (33%) Gaps:229/861 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 NGANLVCEA--------KNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSN 373
            :|.:.||..        :||....||     .||             |..:|....|.|   ..:
  Fly    53 SGISQVCSTYVEQDELMQNLDRPVPL-----TTV-------------QGVLGRQAMLPC---DIS 96

  Fly   374 PQAR------ISW--SINGRPLDNSTYKTTSSSDGG-WVSSSNISLTIDSQSRTFIAVCHALNTE 429
            ||.|      :.|  ..:|.|:.|...:........ |.|.:.........|.|..|.....|..
  Fly    97 PQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIR 161

  Fly   430 LTQNVV--------GSHTVN------VLYPPSPPLLTGYN----DGDI--LISGSILKLQCSSAG 474
            :....|        .|.|.|      |:.||..|::.|.|    .|::  ...|:.:.|.|..:|
  Fly   162 IEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSG 226

  Fly   475 GNPPPTLQWY-KNDKIINAPSKLVDSKITSELSL-LVNASDNNAIYKCKVQNAAIDIPLFATKTL 537
            |.|.|.:.|| .|..|..:..:..|.|..:.||. .|.....|:...|...|..:..|......|
  Fly   227 GRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNNRVVIL 291

  Fly   538 GVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNL-ANRPGLWGGSV 601
            .|:..|..|.|....:.:.......:.|.||.|.|||.|:|||....::.|.. .|.|.....|:
  Fly   292 DVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSI 356

  Fly   602 STLEMYVNITQDLDGIVYTCQSHNEVLQRS-VHETISLDILYPPKFETPQSTTFVG--------V 657
            .|   :....:| ||...||::.|:.:..| :.:...|.:.|     .|.:|..:|        .
  Fly   357 LT---FTPGRED-DGKYLTCRAENQFIDGSAIEDKWRLIVHY-----QPTTTLKIGSSLNPDDIK 412

  Fly   658 EGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALN 722
            ||...:.|.:...||.....:|..:|..:..| :|...::|| ..|.:..:||..||.|.|.|:|
  Fly   413 EGDDAYFECIVLANPKPYKMSWFHNGKELQHN-ISAGVILSD-QSLVLQSVSRASAGDYTCLAVN 475

  Fly   723 SQGTALLE-IQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDGYDLATRTI 786
            |:|..... :.:.:.|||                                               
  Fly   476 SEGKGPSNPVTLRIRYAP----------------------------------------------- 493

  Fly   787 SSFENGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAP---EIDHSPGFTRYAARL 848
                                   .|..|::....|.::     :|.|   |:|.||         
  Fly   494 -----------------------ICATDHEELLGALKH-----ETLPLKCEVDSSP--------- 521

  Fly   849 GVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPD-DYGQY 912
                         |..||.|..:....:.:...:..|.|..:..||:       ..|.| |||..
  Fly   522 -------------PADSFQWTFNSSGEQTELPARLHSSETGMSRLNY-------TPSTDLDYGTI 566

  Fly   913 ECVVRNSLGQASTTLEFS--KPSRPDAPLQ-LRVGNVSDTGVDLNWTPGFDGGMQTYFRLRLKQH 974
            .|..:||:|...:...|.  ...|| .||| ..|.|.|...:.::...|||||:...|.|.|.: 
  Fly   567 SCWAKNSIGTQKSPCVFQIVAAGRP-FPLQNCSVTNQSVDSLQVDCLEGFDGGLPQGFMLELVE- 629

  Fly   975 GEDKYKYVDAKPGHQNIS---------LDGLKPGATYYFSVMAANEAGGSK--FMPDIKLTLSKG 1028
                   ::.....:||:         :|.|...|||...:.|.|..|.|:  .:.||..   ||
  Fly   630 -------LNTLRLARNITVSHTPVTFVIDNLDQAATYRMVIFAVNAKGRSEPTIIDDINF---KG 684

  Fly  1029 SQPHSAEYTEKDELPNVMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAEPSNDDVYSKDDS 1093
            ....:...|......:..:.|:|....:|..:...::| .:.||.:..:|            |.:
  Fly   685 VAKFTGASTGLSMPLSPFLAGLTLFCGLLFAIFCIMLA-AIYRRISNRRS------------DSN 736

  Fly  1094 QSVYKLPITALQADVQ 1109
            ..|.|.....:.||.|
  Fly   737 LKVAKHTQLTIPADCQ 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353
Ig 162..232 CDD:472250
Ig strand B 162..167 CDD:409353
Ig strand C 177..181 CDD:409353
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250 7/32 (22%)
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand F 320..325 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 17/96 (18%)
Ig strand B 363..367 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 2/11 (18%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 1/4 (25%)
Ig 443..527 CDD:472250 25/91 (27%)
Ig strand B 466..470 CDD:409353 1/3 (33%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 1/3 (33%)
Ig strand F 517..522 CDD:409353 1/4 (25%)
Ig 554..640 CDD:472250 24/87 (28%)
Ig strand B 561..565 CDD:409353 0/3 (0%)
Ig strand C 575..579 CDD:409353 1/3 (33%)
Ig strand E 602..608 CDD:409353 1/5 (20%)
Ig strand F 618..623 CDD:409353 2/4 (50%)
Ig strand G 633..636 CDD:409353 0/2 (0%)
Ig_3 643..722 CDD:464046 22/86 (26%)
Ig 748..829 CDD:472250 3/80 (4%)
Ig strand B 756..760 CDD:409353 0/3 (0%)
Ig strand C 769..775 CDD:409353 0/5 (0%)
Ig strand E 792..798 CDD:409353 0/5 (0%)
Ig strand F 808..813 CDD:409353 1/4 (25%)
Ig strand G 822..825 CDD:409353 0/2 (0%)
Ig_3 833..918 CDD:464046 19/88 (22%)
FN3 <932..1151 CDD:442628 45/190 (24%)
FN3 935..1017 CDD:238020 26/93 (28%)
side-IVNP_001034052.2 V-set 79..188 CDD:462230 23/124 (19%)
Ig 210..281 CDD:472250 19/70 (27%)
Ig strand B 218..222 CDD:409353 1/3 (33%)
Ig strand C 232..236 CDD:409353 0/3 (0%)
Ig <317..392 CDD:472250 24/78 (31%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 355..359 CDD:409353 2/6 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 411..479 CDD:472250 21/69 (30%)
Ig strand B 417..421 CDD:409353 0/3 (0%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 1/3 (33%)
Ig strand F 468..473 CDD:409353 2/4 (50%)
Ig 494..576 CDD:472250 25/115 (22%)
Ig strand B 511..515 CDD:409353 1/3 (33%)
Ig strand C 525..529 CDD:409353 2/3 (67%)
Ig strand E 551..555 CDD:409353 1/3 (33%)
Ig strand F 566..570 CDD:409353 1/3 (33%)
fn3 593..675 CDD:394996 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.