DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Cadm2

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_038944379.1 Gene:Cadm2 / 360687 RGDID:1305678 Length:444 Species:Rattus norvegicus


Alignment Length:465 Identity:97/465 - (20%)
Similarity:156/465 - (33%) Gaps:153/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFHLTPHDLQILEGTDTLLRCEV-SNRAGKVQWTK---------DGFALGFSAVIPGFPRYSVLV 94
            :|.|| .::.::||...:|.|.| .|....:||:.         |..||..:.:        .||
  Rat    34 QFPLT-QNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRI--------ELV 89

  Fly    95 DAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEE 159
            .|..:..::.:.:.:|.|:.:|.|.:...   |...:.|.|:::..|....|.|::.    .|.|
  Rat    90 RASWHELSISVSDVSLSDEGQYTCSLFTM---PVKTSKAYLTVLGVPEKPQISGFSS----PVME 147

  Fly   160 RQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSC 224
            ...:.|.|....:.|||:|.||:.:..:.....:.......|.||.||||..:....||.....|
  Rat   148 GDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVIC 212

  Fly   225 EARHKAL--PPDVPMRAQVQLSVLYP------PGAPFFEGYSQGETLHRGQEVQIACRSRGGNPP 281
            ...|::|  .|.|.|:.   |.:.|.      |..||.:         .||.:.:.|.|:|...|
  Rat   213 RVDHESLNATPQVAMQV---LEIHYTPSVKIIPSTPFPQ---------EGQALTLTCESKGKPLP 265

  Fly   282 AQLTWYRNGVAISSPQR--TSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLY 344
            ..:.|.::|..:..|.|  .|||                                  |||:..| 
  Rat   266 EPVLWTKDGAELPDPDRMVVSGR----------------------------------ELNILFL- 295

  Fly   345 APKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNIS 409
                                                    ...||.||:..:::           
  Rat   296 ----------------------------------------NKTDNGTYRCEATN----------- 309

  Fly   410 LTIDSQSRTFIAVCHAL-NTELTQNVVGS-------HTVNVLYPPS----------PPLLTGYND 456
             ||...|..::.:.|.: ||.|...::.|       .||.:...||          |..|.|.|.
  Rat   310 -TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTAPVTTTVAITTSPSTSASSSSRRDPNSLAGQNG 373

  Fly   457 GDILISGSIL 466
            .|..:.|.|:
  Rat   374 PDHALIGGIV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 21/101 (21%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/13 (23%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 20/71 (28%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 3/3 (100%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 20/103 (19%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 0/4 (0%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 11/88 (13%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 9/34 (26%)
Ig strand B 466..470 CDD:409353 0/1 (0%)
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
Cadm2XP_038944379.1 IgV_1_Necl-3 35..130 CDD:409498 24/106 (23%)
Ig strand A 35..38 CDD:409498 1/2 (50%)
FR1 36..54 CDD:409498 5/18 (28%)
Ig strand A' 39..45 CDD:409498 0/5 (0%)
Ig strand B 47..55 CDD:409498 2/7 (29%)
CDR1 55..60 CDD:409498 2/4 (50%)
FR2 61..68 CDD:409498 2/6 (33%)
Ig strand C 61..67 CDD:409498 2/5 (40%)
CDR2 69..80 CDD:409498 1/10 (10%)
Ig strand C' 71..75 CDD:409498 0/3 (0%)
Ig strand C' 77..80 CDD:409498 1/2 (50%)
FR3 81..116 CDD:409498 8/42 (19%)
Ig strand D 85..92 CDD:409498 2/14 (14%)
Ig strand E 95..101 CDD:409498 0/5 (0%)
Ig strand F 108..116 CDD:409498 2/7 (29%)
CDR3 117..120 CDD:409498 0/5 (0%)
Ig strand G 120..130 CDD:409498 2/9 (22%)
FR4 122..129 CDD:409498 2/6 (33%)
IgI_2_Necl-3 129..232 CDD:409467 29/109 (27%)
Ig strand A 130..133 CDD:409467 0/2 (0%)
Ig strand A' 136..140 CDD:409467 1/3 (33%)
Ig strand B 149..159 CDD:409467 2/9 (22%)
Ig strand C 162..171 CDD:409467 6/8 (75%)
Ig strand C' 172..175 CDD:409467 0/2 (0%)
Ig strand D 177..184 CDD:409467 0/6 (0%)
Ig strand E 190..200 CDD:409467 6/9 (67%)
Ig strand F 208..216 CDD:409467 1/7 (14%)
Ig strand G 224..231 CDD:409467 2/9 (22%)
Ig_3 236..309 CDD:464046 24/156 (15%)
4.1m 397..415 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.