DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and CG31773

DIOPT Version :9

Sequence 1:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster


Alignment Length:640 Identity:119/640 - (18%)
Similarity:211/640 - (32%) Gaps:210/640 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 PPPTLQWYKNDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVHF 541
            ||...:..||...:.|.|....:.|:.:.|:.....|..|.:..||.                  
  Fly    74 PPQQAEIKKNPLTMGAISPAPPTPISPKPSVQPKIPDQRAKWMAKVS------------------ 120

  Fly   542 PPET---VKISVV--------PKN----------LVPGIRAKLICDSSSSN----PPAKISWWKD 581
             ||:   .|::..        |||          .:||       .||.:|    |..:.||.: 
  Fly   121 -PESQRKAKLAAAGGSPPSGPPKNQFSQANNPSFAMPG-------QSSPANFSAAPKTQASWQQ- 176

  Fly   582 GIPVEGLNLANRPGLWGG--SVSTLEMYVNITQD---------LDGIVYTCQSHNEV----LQRS 631
              .||........|.:.|  |.|..:.::|..|.         |..:....|:..::    :|:.
  Fly   177 --KVEKSAENEDSGAFKGASSESQRKNWMNRMQGSQQRKQNQWLKEMQAKQQAGKDIQAQKMQKM 239

  Fly   632 VHETISLDILYPPKF---ETPQSTTFVGVEGAPFHV------------ELLASGNPMVITYTWTK 681
            ..:..:.....|||.   .|||... ...|.:|.|:            ::|...:....|.:..|
  Fly   240 ESQKATTTPAAPPKEAAPSTPQPAE-KPEEKSPEHLAYLDAIKQLNSYQVLEPTSGRATTKSSRK 303

  Fly   682 DGLPISSNSLSGQRLISDGPRLNISRLSRND-AGVYICEALNSQG----TALLE-------IQVA 734
            :..|:...:|.         .|..|.|::.| ..:.:.:...|:|    .|::|       ::..
  Fly   304 EQDPVIEQTLE---------CLEKSGLTKKDLKAIPVIQVAGSKGRGSTCAIVESILRCHGVKTG 359

  Fly   735 VEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDGYDLAT----------RTISSF 789
            |..:|.:...|| |..:.|||        ...::...:.| :...|||.          .|:.:|
  Fly   360 VLSSPHLFLTSE-RIRIDGEP--------LSDVQFTELFW-KINTDLANMQPTPSYNKIMTVMAF 414

  Fly   790 EN-GTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFT----RYAARLG 849
            .. ..|.:::|.:|   :||        .||..|.|:....||.       |.|    ..::.||
  Fly   415 HAFHQAGVEVAILE---VGN--------AGASDATNIASHAQTI-------GITTLGWEQSSNLG 461

  Fly   850 VRAQLIC---RSLASPQPSF---IWRRHGKDLKMQRRNKFKSVERQVDALN------FESALLIE 902
            ...:.|.   .|:..|:.:.   :.:....::..|:..:..:..|:|...|      ..:.||:.
  Fly   462 NSLRDIAWAKASIMKPEANIYTNVTQTECCEVLAQKAKQIGAQLRRVPTFNDYVEGDMNNKLLMN 526

  Fly   903 NTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLN---WTPGFDGGMQ 964
            ..:      |...:..||. .....:|.|..:|:..:          |::.|   .|||...|::
  Fly   527 KAN------YSMRLNGSLA-VQLAYDFLKRHKPEYVV----------GLEHNSTLLTPGASRGIE 574

  Fly   965 TYFRLRLKQHGEDKYKYVDAKPGH--------QNISLDGLKPGATYYFSVMAANE 1011
            .:                 .:|||        .|:.||    .|..:.|:||..:
  Fly   575 IF-----------------EQPGHFDFMRHDMFNVYLD----SADTFESMMACRD 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_001286439.1 Ig 44..122 CDD:299845
IG_like 45..137 CDD:214653
Ig 153..231 CDD:299845
IG_like 258..342 CDD:214653
Ig 266..327 CDD:299845
IG_like 357..>414 CDD:214653
Ig 360..427 CDD:299845
Ig <468..526 CDD:299845 12/48 (25%)
I-set 547..633 CDD:254352 23/122 (19%)
Ig 556..631 CDD:299845 19/93 (20%)
I-set 644..735 CDD:254352 21/117 (18%)
IGc2 668..725 CDD:197706 9/57 (16%)
IG_like 751..829 CDD:214653 18/88 (20%)
IGc2 753..815 CDD:197706 14/72 (19%)
Ig 852..928 CDD:143165 12/87 (14%)
FN3 935..1017 CDD:238020 17/88 (19%)
CG31773NP_722953.1 folC 309..745 CDD:273659 69/375 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.