DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and kirre

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_525059.2 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:513 Identity:133/513 - (25%)
Similarity:224/513 - (43%) Gaps:69/513 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNL 103
            |.|.:.|.|...:.|:...|.|.|..:.|.:|||||.|.||....:.||.|||::...::..::|
  Fly    82 QHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSL 146

  Fly   104 QIKNATLEDDAEYQCQVGPA-AGNPAIRAN-AKLSIVAAPSS-IVIEGYARNARVEVEERQNLTL 165
            .|....|:|||:|||||||. .|...||:. |||:::..|.: .:.:|   :..|..|:|: :.|
  Fly   147 DIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQG---DYLVTTEDRE-IEL 207

  Fly   166 HCIAENANPAAEIVWFQGEVPVSTAPIVTVNQ--TAPKRFTTSSTLHLQPRAEDDYKEFSCEARH 228
            .|:::...|||||.|..|...|.|..|..|.:  ...:|.|..|.|.|.|:.|.....|:|:|::
  Fly   208 ECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQN 272

  Fly   229 KALPPDVPMR-AQVQLSVLYPPG--APFFEGYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNG 290
            .|   |...| |::.|.|.|.|.  .....|...|..:..|.||.::|::..........|:.| 
  Fly   273 TA---DRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIN- 333

  Fly   291 VAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTV--LYAPKDVYLSG 353
                 .:..:|..:..:.....:.:.:.|.:.||..|.:..:....:|:::.  ::..:.|.:  
  Fly   334 -----DELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSV-- 391

  Fly   354 ANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDG--GWVSSSNISLTIDSQS 416
              :|.:|.:|.:.|..| .||:..|.|             .:.:||.  |..:...:.::.::..
  Fly   392 --EADLGATVSMRCDVA-GNPEPEIEW-------------ISENSDQVVGVAAELKLKVSSETAG 440

  Fly   417 RTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGY--NDGDILISGSILKLQCSSAGGNPPP 479
            |.|   |.|:.....:  :|:..  .||....|::|.:  ..|.:   |..:|:.|.:.......
  Fly   441 RYF---CKAVVNGFPE--IGAEA--TLYVKRAPIITSHKVQFGGV---GGRVKIDCLAFSIPKAE 495

  Fly   480 TLQWYKNDKIINAPSKLVDSKITSE--------LSLLVNASDNNAI----YKCKVQNA 525
            .:.|....||||..|...|..|..|        .:|::.  |:.|.    |.|.|.|:
  Fly   496 HILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIR--DSKATHFGKYNCTVMNS 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 39/93 (42%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 2/13 (15%)
Ig strand F 115..120 CDD:409353 3/4 (75%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig 162..232 CDD:472250 24/71 (34%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 2/3 (67%)
Ig strand E 207..211 CDD:409353 2/3 (67%)
Ig strand F 221..226 CDD:409353 2/4 (50%)
Ig 246..342 CDD:472250 16/97 (16%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 17/89 (19%)
Ig strand B 363..367 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 1/4 (25%)
Ig 443..527 CDD:472250 24/97 (25%)
Ig strand B 466..470 CDD:409353 1/3 (33%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 1/11 (9%)
Ig strand F 517..522 CDD:409353 2/8 (25%)
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
kirreNP_525059.2 IG_like 88..182 CDD:214653 39/93 (42%)
Ig strand B 99..103 CDD:409552 1/3 (33%)
Ig strand E 144..148 CDD:409552 1/3 (33%)
Ig strand F 158..163 CDD:409552 3/4 (75%)
C2-set_2 189..279 CDD:400489 29/96 (30%)
Ig strand C 219..223 CDD:409416 2/3 (67%)
Ig strand E 251..255 CDD:409416 2/3 (67%)
Ig strand F 265..270 CDD:409416 2/4 (50%)
Ig strand G 280..283 CDD:409416 1/2 (50%)
Ig_2 307..379 CDD:464026 12/77 (16%)
Ig 382..462 CDD:472250 19/104 (18%)
Ig strand B 399..403 CDD:409353 1/3 (33%)
Ig strand C 412..417 CDD:409353 2/17 (12%)
Ig strand F 441..446 CDD:409353 3/7 (43%)
Ig strand G 455..458 CDD:409353 1/2 (50%)
Ig 466..561 CDD:472250 22/91 (24%)
Ig strand B 482..486 CDD:409353 1/3 (33%)
Ig strand C 496..500 CDD:409353 0/3 (0%)
Ig strand E 529..533 CDD:409353 1/3 (33%)
Ig strand F 543..548 CDD:409353 2/4 (50%)
Ig strand G 556..559 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.