DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and rst

DIOPT Version :9

Sequence 1:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:701 Identity:180/701 - (25%)
Similarity:284/701 - (40%) Gaps:143/701 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HVMAAVTAPTPAAQVAAPPV-----QKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFAL 78
            |.|..:...|....|.:.|.     |:|.:.|.|...:.|....|.|.|.|:.|.:|||||.|.|
  Fly     3 HTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGL 67

  Fly    79 GFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPA-AGNPAIRAN-AKLSIVAAP 141
            |.|..:.||.||:::...::..|:|.|....|:|||.|||||.|. .|.||||:. |.|:::..|
  Fly    68 GTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPP 132

  Fly   142 SS-IVIEG---YA-RNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPI--VTVNQTA 199
            .: .:.:|   || .:.:||:|        |::....|||||.|..|...|.|..|  ..:....
  Fly   133 EAPKITQGDVIYATEDRKVEIE--------CVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPD 189

  Fly   200 PKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMR-AQVQLSVLYPP------------GA 251
            .:|||..|.|.|.|:.|.....|||:|::.|   |...| |::::.|.|.|            ||
  Fly   190 QRRFTAKSVLRLTPKKEHHNTNFSCQAQNTA---DRTYRSAKIRVEVKYAPKVKVNVMGSLPGGA 251

  Fly   252 PFFEGYSQGETLHRG--------QEVQIACRSRGGNPPAQLTWYRNGVAISSPQRTSGRLSENVY 308
            ....|.:.|.::|..        .:|::.||:.......:..|:.|...|...|:|...:.....
  Fly   252 GGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTR 316

  Fly   309 KFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSN 373
            ||      :.|.:.||.:|.:..:.....|:::  |||.......:.:|.||..|.|:| ...||
  Fly   317 KF------HDAIVKCEVQNSVGKSEDSETLDIS--YAPSFRQRPQSMEADVGSVVSLTC-EVDSN 372

  Fly   374 PQARISWSINGRPLD-------NSTYKTTSSSDGGWVSSSNIS--LTIDSQSRTFIAVCHALNTE 429
            ||..|.|.  ..|.|       |.|:..::.:.|.:...:|:.  ..|.:.:..::....|:.::
  Fly   373 PQPEIVWI--QHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQ 435

  Fly   430 LTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPS 494
            .||                     |.     :.|...:::|.::.......:.|..|.:.|::.|
  Fly   436 RTQ---------------------YG-----LVGDTARIECFASSVPRARHVSWTFNGQEISSES 474

  Fly   495 K-----LVDSKITSELSLLVNASDNNAI----YKCKV----QNAAIDIPLFATKTLGVHFPPETV 546
            .     |||:......|.|: ..|:.|.    |.|.|    .|...:|.|.|.|::.:..   |:
  Fly   475 GHDYSILVDAVPGGVKSTLI-IRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM---TI 535

  Fly   547 --KISVVPKNLVPGIRAKLI--CDSSSSNPPAKI----SWWKDGIPVEGLNLANRPGLWGGSVST 603
              .||||...||..|...:.  |...:..|||.:    ...|:|    |::....||      ..
  Fly   536 VGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNG----GVSCKLEPG------DR 590

  Fly   604 LEMYVNITQDLDG--IVYTCQSHNEVLQRSVHETISLDILYPPKFETPQST 652
            ...|.::..|:.|  :.|.        ..|.|.:      .||::.|..||
  Fly   591 TSNYSDLKVDISGGYVPYG--------DYSTHYS------PPPQYLTTCST 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_001286439.1 Ig 44..122 CDD:299845 33/77 (43%)
IG_like 45..137 CDD:214653 41/93 (44%)
Ig 153..231 CDD:299845 26/79 (33%)
IG_like 258..342 CDD:214653 17/91 (19%)
Ig 266..327 CDD:299845 13/68 (19%)
IG_like 357..>414 CDD:214653 19/65 (29%)
Ig 360..427 CDD:299845 18/75 (24%)
Ig <468..526 CDD:299845 16/70 (23%)
I-set 547..633 CDD:254352 21/93 (23%)
Ig 556..631 CDD:299845 15/82 (18%)
I-set 644..735 CDD:254352 4/9 (44%)
IGc2 668..725 CDD:197706
IG_like 751..829 CDD:214653
IGc2 753..815 CDD:197706
Ig 852..928 CDD:143165
FN3 935..1017 CDD:238020
rstNP_001284835.1 IG_like 34..130 CDD:214653 41/95 (43%)
Ig 42..114 CDD:299845 32/71 (45%)
C2-set_2 135..225 CDD:285423 31/100 (31%)
Ig_3 265..329 CDD:290638 13/69 (19%)
I-set 346..420 CDD:254352 20/76 (26%)
Ig 360..425 CDD:299845 17/67 (25%)
Ig5_KIRREL3-like 428..524 CDD:143235 22/122 (18%)
IG_like 435..524 CDD:214653 21/115 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.