DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and rst

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_525058.2 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:701 Identity:180/701 - (25%)
Similarity:284/701 - (40%) Gaps:143/701 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HVMAAVTAPTPAAQVAAPPV-----QKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFAL 78
            |.|..:...|....|.:.|.     |:|.:.|.|...:.|....|.|.|.|:.|.:|||||.|.|
  Fly     3 HTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGL 67

  Fly    79 GFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPA-AGNPAIRAN-AKLSIVAAP 141
            |.|..:.||.||:::...::..|:|.|....|:|||.|||||.|. .|.||||:. |.|:::..|
  Fly    68 GTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPP 132

  Fly   142 SS-IVIEG---YA-RNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPI--VTVNQTA 199
            .: .:.:|   || .:.:||:|        |::....|||||.|..|...|.|..|  ..:....
  Fly   133 EAPKITQGDVIYATEDRKVEIE--------CVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPD 189

  Fly   200 PKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMR-AQVQLSVLYPP------------GA 251
            .:|||..|.|.|.|:.|.....|||:|::.|   |...| |::::.|.|.|            ||
  Fly   190 QRRFTAKSVLRLTPKKEHHNTNFSCQAQNTA---DRTYRSAKIRVEVKYAPKVKVNVMGSLPGGA 251

  Fly   252 PFFEGYSQGETLHRG--------QEVQIACRSRGGNPPAQLTWYRNGVAISSPQRTSGRLSENVY 308
            ....|.:.|.::|..        .:|::.||:.......:..|:.|...|...|:|...:.....
  Fly   252 GGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTR 316

  Fly   309 KFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSN 373
            ||      :.|.:.||.:|.:..:.....|:::  |||.......:.:|.||..|.|:| ...||
  Fly   317 KF------HDAIVKCEVQNSVGKSEDSETLDIS--YAPSFRQRPQSMEADVGSVVSLTC-EVDSN 372

  Fly   374 PQARISWSINGRPLD-------NSTYKTTSSSDGGWVSSSNIS--LTIDSQSRTFIAVCHALNTE 429
            ||..|.|.  ..|.|       |.|:..::.:.|.:...:|:.  ..|.:.:..::....|:.::
  Fly   373 PQPEIVWI--QHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQ 435

  Fly   430 LTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPS 494
            .||                     |.     :.|...:::|.::.......:.|..|.:.|::.|
  Fly   436 RTQ---------------------YG-----LVGDTARIECFASSVPRARHVSWTFNGQEISSES 474

  Fly   495 K-----LVDSKITSELSLLVNASDNNAI----YKCKV----QNAAIDIPLFATKTLGVHFPPETV 546
            .     |||:......|.|: ..|:.|.    |.|.|    .|...:|.|.|.|::.:..   |:
  Fly   475 GHDYSILVDAVPGGVKSTLI-IRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM---TI 535

  Fly   547 --KISVVPKNLVPGIRAKLI--CDSSSSNPPAKI----SWWKDGIPVEGLNLANRPGLWGGSVST 603
              .||||...||..|...:.  |...:..|||.:    ...|:|    |::....||      ..
  Fly   536 VGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNG----GVSCKLEPG------DR 590

  Fly   604 LEMYVNITQDLDG--IVYTCQSHNEVLQRSVHETISLDILYPPKFETPQST 652
            ...|.::..|:.|  :.|.        ..|.|.:      .||::.|..||
  Fly   591 TSNYSDLKVDISGGYVPYG--------DYSTHYS------PPPQYLTTCST 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 41/93 (44%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 2/13 (15%)
Ig strand F 115..120 CDD:409353 3/4 (75%)
Ig strand G 128..131 CDD:409353 2/2 (100%)
Ig 162..232 CDD:472250 24/71 (34%)
Ig strand B 162..167 CDD:409353 0/4 (0%)
Ig strand C 177..181 CDD:409353 2/3 (67%)
Ig strand E 207..211 CDD:409353 2/3 (67%)
Ig strand F 221..226 CDD:409353 3/4 (75%)
Ig 246..342 CDD:472250 22/115 (19%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 23/96 (24%)
Ig strand B 363..367 CDD:409353 2/3 (67%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 406..410 CDD:409353 1/5 (20%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 18/96 (19%)
Ig strand B 466..470 CDD:409353 0/3 (0%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 0/3 (0%)
Ig strand F 517..522 CDD:409353 2/8 (25%)
Ig 554..640 CDD:472250 18/93 (19%)
Ig strand B 561..565 CDD:409353 0/5 (0%)
Ig strand C 575..579 CDD:409353 0/7 (0%)
Ig strand E 602..608 CDD:409353 0/5 (0%)
Ig strand F 618..623 CDD:409353 1/4 (25%)
Ig strand G 633..636 CDD:409353 1/2 (50%)
Ig_3 643..722 CDD:464046 5/10 (50%)
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
rstNP_525058.2 Ig 29..110 CDD:472250 33/80 (41%)
Ig strand B 45..49 CDD:409353 1/3 (33%)
Ig strand E 90..94 CDD:409353 2/3 (67%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
C2-set_2 135..225 CDD:400489 31/100 (31%)
Ig strand B 151..155 CDD:409353 3/11 (27%)
Ig strand C 165..169 CDD:409353 2/3 (67%)
Ig strand E 197..201 CDD:409353 2/3 (67%)
Ig strand F 211..216 CDD:409353 3/4 (75%)
Ig strand G 226..229 CDD:409353 1/2 (50%)
Ig 271..340 CDD:472250 14/74 (19%)
Ig_3 346..411 CDD:464046 18/67 (27%)
Ig 428..524 CDD:472250 22/122 (18%)
Ig strand B 446..450 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 491..495 CDD:409353 2/4 (50%)
Ig strand F 505..510 CDD:409353 2/4 (50%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.