DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and CADM2

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:465 Identity:96/465 - (20%)
Similarity:156/465 - (33%) Gaps:153/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFHLTPHDLQILEGTDTLLRCEV-SNRAGKVQWTK---------DGFALGFSAVIPGFPRYSVLV 94
            :|.|| .::.::||...:|.|.| .|....:||:.         |..||..:.:        .||
Human    39 QFPLT-QNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRI--------ELV 94

  Fly    95 DAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEE 159
            .|..:..::.:.:.:|.|:.:|.|.:...   |...:.|.|:::..|....|.|::.    .|.|
Human    95 RASWHELSISVSDVSLSDEGQYTCSLFTM---PVKTSKAYLTVLGVPEKPQISGFSS----PVME 152

  Fly   160 RQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSC 224
            ...:.|.|....:.|||:|.||:.:..:.....:.......|.||.||||..:....||.....|
Human   153 GDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVIC 217

  Fly   225 EARHKAL--PPDVPMRAQVQLSVLYP------PGAPFFEGYSQGETLHRGQEVQIACRSRGGNPP 281
            ...|::|  .|.|.|:.   |.:.|.      |..||.:         .||.:.:.|.|:|...|
Human   218 RVDHESLNATPQVAMQV---LEIHYTPSVKIIPSTPFPQ---------EGQPLILTCESKGKPLP 270

  Fly   282 AQLTWYRNGVAISSPQR--TSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLY 344
            ..:.|.::|..:..|.|  .|||                                  |||:..| 
Human   271 EPVLWTKDGGELPDPDRMVVSGR----------------------------------ELNILFL- 300

  Fly   345 APKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNIS 409
                                                    ...||.||:..:::           
Human   301 ----------------------------------------NKTDNGTYRCEATN----------- 314

  Fly   410 LTIDSQSRTFIAVCHAL-NTELTQNVVGS-------HTVNVLYPPS----------PPLLTGYND 456
             ||...|..::.:.|.: ||.|...::.|       .||.:...|:          |..|.|.|.
Human   315 -TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNG 378

  Fly   457 GDILISGSIL 466
            .|..:.|.|:
Human   379 PDHALIGGIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 21/101 (21%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/13 (23%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 20/71 (28%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 3/3 (100%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 20/103 (19%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 0/4 (0%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 11/88 (13%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 8/34 (24%)
Ig strand B 466..470 CDD:409353 0/1 (0%)
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
CADM2XP_016861551.1 IgV_1_Necl-3 40..135 CDD:409498 24/106 (23%)
Ig strand A 40..43 CDD:409498 1/2 (50%)
FR1 41..59 CDD:409498 5/18 (28%)
Ig strand A' 44..50 CDD:409498 0/5 (0%)
Ig strand B 52..60 CDD:409498 2/7 (29%)
CDR1 60..65 CDD:409498 2/4 (50%)
FR2 66..73 CDD:409498 2/6 (33%)
Ig strand C 66..72 CDD:409498 2/5 (40%)
CDR2 74..85 CDD:409498 1/10 (10%)
Ig strand C' 76..80 CDD:409498 0/3 (0%)
Ig strand C' 82..85 CDD:409498 1/2 (50%)
FR3 86..121 CDD:409498 8/42 (19%)
Ig strand D 90..97 CDD:409498 2/14 (14%)
Ig strand E 100..106 CDD:409498 0/5 (0%)
Ig strand F 113..121 CDD:409498 2/7 (29%)
CDR3 122..125 CDD:409498 0/5 (0%)
Ig strand G 125..135 CDD:409498 2/9 (22%)
FR4 127..134 CDD:409498 2/6 (33%)
IgI_2_Necl-3 134..237 CDD:409467 29/109 (27%)
Ig strand A 135..138 CDD:409467 0/2 (0%)
Ig strand A' 141..145 CDD:409467 1/3 (33%)
Ig strand B 154..164 CDD:409467 2/9 (22%)
Ig strand C 167..176 CDD:409467 6/8 (75%)
Ig strand C' 177..180 CDD:409467 0/2 (0%)
Ig strand D 182..189 CDD:409467 0/6 (0%)
Ig strand E 195..205 CDD:409467 6/9 (67%)
Ig strand F 213..221 CDD:409467 1/7 (14%)
Ig strand G 229..236 CDD:409467 2/9 (22%)
Ig_3 241..314 CDD:464046 24/156 (15%)
4.1m 402..420 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.