DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Cadm2

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_011244430.1 Gene:Cadm2 / 239857 MGIID:2442722 Length:458 Species:Mus musculus


Alignment Length:486 Identity:100/486 - (20%)
Similarity:160/486 - (32%) Gaps:159/486 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HVMAAVTAPTPAAQVAAPPVQKFHLTPHDLQILEGTDTLLRCEV-SNRAGKVQWTK--------- 73
            |..||..:....:|...|..|       ::.::||...:|.|.| .|....:||:.         
Mouse    33 HQAAASKSKVKGSQGQFPLTQ-------NVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFD 90

  Fly    74 DGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIV 138
            |..||..:.:        .||.|..:..::.:.:.:|.|:.:|.|.:...   |...:.|.|:::
Mouse    91 DKKALRDNRI--------ELVRASWHELSISVSDVSLSDEGQYTCSLFTM---PVKTSKAYLTVL 144

  Fly   139 AAPSSIVIEGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQTAPKRF 203
            ..|....|.|::.    .|.|...:.|.|....:.|||:|.||:.:..:.....:.......|.|
Mouse   145 GVPEKPQISGFSS----PVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTF 205

  Fly   204 TTSSTLHLQPRAEDDYKEFSCEARHKAL--PPDVPMRAQVQLSVLYP------PGAPFFEGYSQG 260
            |.||||..:....||.....|...|::|  .|.|.|:.   |.:.|.      |..||.:     
Mouse   206 TVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQV---LEIHYTPSVKIIPSTPFPQ----- 262

  Fly   261 ETLHRGQEVQIACRSRGGNPPAQLTWYRNGVAISSPQR--TSGRLSENVYKFTAAAEDNGANLVC 323
                .||.:.:.|.|:|...|..:.|.::|..:..|.|  .|||                     
Mouse   263 ----EGQALTLTCESKGKPLPEPVLWTKDGAELPDPDRMVVSGR--------------------- 302

  Fly   324 EAKNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLD 388
                         |||:..|                                         ...|
Mouse   303 -------------ELNILFL-----------------------------------------NKTD 313

  Fly   389 NSTYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHAL-NTELTQNVVGSHT-------VNVLYP 445
            |.||:..:::            ||...|..::.:.|.: ||.|...::.|.|       |.:...
Mouse   314 NGTYRCEATN------------TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTAPVTTSVTITTS 366

  Fly   446 PS----------PPLLTGYNDGDILISGSIL 466
            ||          |..|.|.|..|..:.|.|:
Mouse   367 PSTSASSSSRRDPNSLAGQNGPDHALIGGIV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 21/101 (21%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 91..105 CDD:409353 3/13 (23%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig 162..232 CDD:472250 20/71 (28%)
Ig strand B 162..167 CDD:409353 1/4 (25%)
Ig strand C 177..181 CDD:409353 1/3 (33%)
Ig strand E 207..211 CDD:409353 3/3 (100%)
Ig strand F 221..226 CDD:409353 1/4 (25%)
Ig 246..342 CDD:472250 20/103 (19%)
Ig strand B 269..273 CDD:409353 0/3 (0%)
Ig strand C 283..287 CDD:409353 0/3 (0%)
Ig strand F 320..325 CDD:409353 0/4 (0%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 11/88 (13%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 0/3 (0%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 9/34 (26%)
Ig strand B 466..470 CDD:409353 0/1 (0%)
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
Cadm2XP_011244430.1 MtrA <9..>56 CDD:453061 6/29 (21%)
IgV_1_Necl-3 49..144 CDD:409498 23/112 (21%)
Ig strand A 49..52 CDD:409498 1/2 (50%)
FR1 50..68 CDD:409498 5/24 (21%)
Ig strand A' 53..59 CDD:409498 1/12 (8%)
Ig strand B 61..69 CDD:409498 2/7 (29%)
CDR1 69..74 CDD:409498 2/4 (50%)
FR2 75..82 CDD:409498 2/6 (33%)
Ig strand C 75..81 CDD:409498 2/5 (40%)
CDR2 83..94 CDD:409498 1/10 (10%)
Ig strand C' 85..89 CDD:409498 0/3 (0%)
Ig strand C' 91..94 CDD:409498 1/2 (50%)
FR3 95..130 CDD:409498 8/42 (19%)
Ig strand D 99..106 CDD:409498 2/14 (14%)
Ig strand E 109..115 CDD:409498 0/5 (0%)
Ig strand F 122..130 CDD:409498 2/7 (29%)
CDR3 131..134 CDD:409498 0/5 (0%)
Ig strand G 134..144 CDD:409498 2/9 (22%)
FR4 136..143 CDD:409498 2/6 (33%)
IgI_2_Necl-3 143..246 CDD:409467 29/109 (27%)
Ig strand A 144..147 CDD:409467 0/2 (0%)
Ig strand A' 150..154 CDD:409467 1/3 (33%)
Ig strand B 163..173 CDD:409467 2/9 (22%)
Ig strand C 176..185 CDD:409467 6/8 (75%)
Ig strand C' 186..189 CDD:409467 0/2 (0%)
Ig strand D 191..198 CDD:409467 0/6 (0%)
Ig strand E 204..214 CDD:409467 6/9 (67%)
Ig strand F 222..230 CDD:409467 1/7 (14%)
Ig strand G 238..245 CDD:409467 2/9 (22%)
Ig_3 250..323 CDD:464046 24/156 (15%)
4.1m 411..429 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.