DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and CADM1

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:74 Identity:18/74 - (24%)
Similarity:29/74 - (39%) Gaps:14/74 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VLEESFTD--KIITTYRDDPDLQNLIDFAQQEFHCCGLSNEGYLDWGKNEYFNCSSPSVEKCGVP 189
            :||:...|  |.:....||.|:      |..:..   ||.:..:...|::|.   :|..:|....
Human   650 ILEKLLKDKRKELGPLPDDDDM------ASPKLK---LSRKSGVSPKKSKYM---TPMQQKLNEV 702

  Fly   190 YSCCINATD 198
            |....|.||
Human   703 YEAVKNYTD 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653 4/11 (36%)
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353 2/2 (100%)
Ig 162..232 CDD:472250 10/37 (27%)
Ig strand B 162..167 CDD:409353 2/4 (50%)
Ig strand C 177..181 CDD:409353 0/3 (0%)
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand F 320..325 CDD:409353
Ig strand G 335..338 CDD:409353
Ig 343..431 CDD:472250
Ig strand B 363..367 CDD:409353
Ig strand C 377..381 CDD:409353
Ig strand E 406..410 CDD:409353
Ig strand F 420..425 CDD:409353
Ig 443..527 CDD:472250
Ig strand B 466..470 CDD:409353
Ig strand C 480..484 CDD:409353
Ig strand E 503..507 CDD:409353
Ig strand F 517..522 CDD:409353
Ig 554..640 CDD:472250
Ig strand B 561..565 CDD:409353
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
CADM1XP_016872946.1 IgV_1_Necl-2 53..146 CDD:409465
FR1 53..71 CDD:409465
Ig strand A 53..55 CDD:409465
Ig strand A' 56..62 CDD:409465
Ig strand B 64..72 CDD:409465
CDR1 72..77 CDD:409465
FR2 78..85 CDD:409465
Ig strand C 78..84 CDD:409465
CDR2 86..97 CDD:409465
Ig strand C' 88..92 CDD:409465
Ig strand C' 94..97 CDD:409465
FR3 98..133 CDD:409465
Ig strand D 102..109 CDD:409465
Ig strand E 112..118 CDD:409465
Ig strand F 125..133 CDD:409465
CDR3 134..137 CDD:409465
Ig strand G 137..146 CDD:409465
FR4 139..146 CDD:409465
IgI_2_Necl-2 147..245 CDD:409466
Ig strand A 147..150 CDD:409466
Ig strand A' 153..157 CDD:409466
Ig strand B 166..176 CDD:409466
Ig strand C 179..188 CDD:409466
Ig strand C' 189..192 CDD:409466
Ig strand D 194..201 CDD:409466
Ig strand E 204..214 CDD:409466
Ig strand F 222..230 CDD:409466
Ig strand G 237..244 CDD:409466
IG_like 258..336 CDD:214653
Ig strand B 269..273 CDD:409353
Ig strand C 282..287 CDD:409353
Ig strand E 301..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
4.1m 430..448 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.