DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and CADM4

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:363 Identity:97/363 - (26%)
Similarity:151/363 - (41%) Gaps:70/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 RAQVQLSVLYP----PGAPFFEGYSQGETLHRGQEVQIACRSR---GG----NPPAQLTWYRNGV 291
            |.|..|.:|:.    |||. .|..::..|:..|...:|.||..   |.    ..||:.|.:.||.
Human     6 RFQWPLLLLWAAAAGPGAG-QEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGT 69

  Fly   292 -AIS---------SPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAEL-NLTVLYA 345
             |:.         ||:|...|||:      |..||.| ...|:    |.|.....:: .||||.|
Human    70 RALKDERFQLEEFSPRRVRIRLSD------ARLEDEG-GYFCQ----LYTEDTHHQIATLTVLVA 123

  Fly   346 PKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGG--WVSSSNI 408
            |::..:....||..|..|:|||:...|.|.|.:.|..:.:.|..    .:||.:.|  |..:|.:
Human   124 PENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKG----VSSSQENGKVWSVASTV 184

  Fly   409 SLTIDSQSRTFIAVCHALNTEL-------TQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSIL 466
            ...:|.:....|.:|.|.|..|       ||     :.::|.|.|:..:   :....::..|..|
Human   185 RFRVDRKDDGGIIICEAQNQALPSGHSKQTQ-----YVLDVQYSPTARI---HASQAVVREGDTL 241

  Fly   467 KLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQN----AAI 527
            .|.|:..|...|..::|.:.::.:...::.|...:|  |..||:|  :|..|.|:..|    |. 
Human   242 VLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLT--LPGLVSA--DNGTYTCEASNKHGHAR- 301

  Fly   528 DIPLFATKTLGVHFPPETVKISV-VPKNLVPGIRAKLI 564
                 |...|.|:.|...|:... ||..:|.||.|.|:
Human   302 -----ALYVLVVYDPGAVVEAQTSVPYAIVGGILALLV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353
Ig 162..232 CDD:472250
Ig strand B 162..167 CDD:409353
Ig strand C 177..181 CDD:409353
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250 31/117 (26%)
Ig strand B 269..273 CDD:409353 1/3 (33%)
Ig strand C 283..287 CDD:409353 1/3 (33%)
Ig strand F 320..325 CDD:409353 1/4 (25%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig 343..431 CDD:472250 26/96 (27%)
Ig strand B 363..367 CDD:409353 2/3 (67%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 1/3 (33%)
Ig strand F 420..425 CDD:409353 2/4 (50%)
Ig 443..527 CDD:472250 20/87 (23%)
Ig strand B 466..470 CDD:409353 2/3 (67%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 1/3 (33%)
Ig strand F 517..522 CDD:409353 2/4 (50%)
Ig 554..640 CDD:472250 5/11 (45%)
Ig strand B 561..565 CDD:409353 2/4 (50%)
Ig strand C 575..579 CDD:409353
Ig strand E 602..608 CDD:409353
Ig strand F 618..623 CDD:409353
Ig strand G 633..636 CDD:409353
Ig_3 643..722 CDD:464046
Ig 748..829 CDD:472250
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
CADM4NP_660339.1 Ig 29..120 CDD:472250 26/101 (26%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 0/3 (0%)
Ig strand E 87..91 CDD:409353 0/3 (0%)
Ig strand F 101..106 CDD:409353 1/8 (13%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 28/107 (26%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 4/9 (44%)
Ig strand C 152..161 CDD:409468 3/8 (38%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 2/10 (20%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 2/11 (18%)
Ig_3 224..295 CDD:464046 17/77 (22%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.