| Sequence 1: | NP_001286439.1 | Gene: | hbs / 44129 | FlyBaseID: | FBgn0029082 | Length: | 1235 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001277948.1 | Gene: | Sirpa / 19261 | MGIID: | 108563 | Length: | 513 | Species: | Mus musculus |
| Alignment Length: | 359 | Identity: | 81/359 - (22%) |
|---|---|---|---|
| Similarity: | 131/359 - (36%) | Gaps: | 89/359 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 360 GDSVQLSCVTAPSNPQARISWSINGRPLDNSTY--------KTTSSSDGGWVSSSNISLTIDSQS 416
Fly 417 RTFIAVCHAL---------NTELTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSS 472
Fly 473 AGGNPPP-TLQWYKN-------DKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAID- 528
Fly 529 IPLFATKTLG--VHFPPETVKI---SVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGL 588
Fly 589 NLANRPGLW--GGSVSTLEMYVNITQDLDG------------------IVYTCQ---------SH 624
Fly 625 NEVLQRSVHETISLDI-LYPPKFETPQSTTFVGV 657 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hbs | NP_001286439.1 | Ig | 44..122 | CDD:299845 | |
| IG_like | 45..137 | CDD:214653 | |||
| Ig | 153..231 | CDD:299845 | |||
| IG_like | 258..342 | CDD:214653 | |||
| Ig | 266..327 | CDD:299845 | |||
| IG_like | 357..>414 | CDD:214653 | 14/61 (23%) | ||
| Ig | 360..427 | CDD:299845 | 14/83 (17%) | ||
| Ig | <468..526 | CDD:299845 | 18/65 (28%) | ||
| I-set | 547..633 | CDD:254352 | 23/117 (20%) | ||
| Ig | 556..631 | CDD:299845 | 20/103 (19%) | ||
| I-set | 644..735 | CDD:254352 | 4/14 (29%) | ||
| IGc2 | 668..725 | CDD:197706 | |||
| IG_like | 751..829 | CDD:214653 | |||
| IGc2 | 753..815 | CDD:197706 | |||
| Ig | 852..928 | CDD:143165 | |||
| FN3 | 935..1017 | CDD:238020 | |||
| Sirpa | NP_001277948.1 | Ig | 35..146 | CDD:416386 | 18/99 (18%) |
| FR1 | 35..56 | CDD:409353 | 4/7 (57%) | ||
| Ig strand A | 35..38 | CDD:409353 | |||
| Ig strand A' | 42..46 | CDD:409353 | |||
| Ig strand B | 49..57 | CDD:409353 | 4/7 (57%) | ||
| CDR1 | 57..63 | CDD:409353 | 0/5 (0%) | ||
| FR2 | 64..72 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 73..87 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 85..88 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..126 | CDD:409353 | 4/37 (11%) | ||
| Ig strand D | 89..93 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 103..109 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 117..124 | CDD:409353 | 0/6 (0%) | ||
| CDR3 | 127..132 | CDD:409353 | 0/4 (0%) | ||
| Ig strand G | 132..137 | CDD:409353 | 2/4 (50%) | ||
| FR4 | 133..146 | CDD:409353 | 4/14 (29%) | ||
| Ig strand G' | 140..145 | CDD:409353 | 1/4 (25%) | ||
| IgC1_SIRP_domain_2 | 148..250 | CDD:409429 | 29/103 (28%) | ||
| Ig strand B | 167..171 | CDD:409429 | 0/3 (0%) | ||
| Ig strand C | 182..186 | CDD:409429 | 2/3 (67%) | ||
| Ig strand E | 212..216 | CDD:409429 | 1/3 (33%) | ||
| Ig strand F | 226..231 | CDD:409429 | 1/4 (25%) | ||
| Ig strand G | 242..245 | CDD:409429 | 0/2 (0%) | ||
| IgC1_SIRP_domain_3 | 253..348 | CDD:409507 | 26/118 (22%) | ||
| Ig strand B | 270..274 | CDD:409507 | 2/8 (25%) | ||
| Ig strand C | 285..289 | CDD:409507 | 1/8 (13%) | ||
| Ig strand E | 315..319 | CDD:409507 | 0/3 (0%) | ||
| Ig strand F | 329..334 | CDD:409507 | 3/4 (75%) | ||
| Ig strand G | 343..346 | CDD:409507 | 0/2 (0%) | ||
| SH2-binding. /evidence=ECO:0000255 | 440..443 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 444..513 | ||||
| SH3-binding. /evidence=ECO:0000255 | 450..455 | ||||
| SH2-binding. /evidence=ECO:0000255 | 464..467 | ||||
| SH2-binding. /evidence=ECO:0000255 | 481..484 | ||||
| SH2-binding. /evidence=ECO:0000255 | 505..508 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||