DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Nectin1

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001093946.1 Gene:Nectin1 / 192183 RGDID:620791 Length:515 Species:Rattus norvegicus


Alignment Length:381 Identity:91/381 - (23%)
Similarity:138/381 - (36%) Gaps:119/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 GSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQ-----WYK-------NDK 488
            |:||..|....|   :.|:...|::       |.||.|  ||.||::     |.|       |..
  Rat    27 GTHTQVVQVNDS---MYGFIGTDVI-------LHCSFA--NPLPTVKITQVTWQKASNGSKQNMA 79

  Fly   489 IIN------------------APSKLVDSKI-TSELSLLVNASDNNAIYKCKVQNAAIDIPLFAT 534
            |.|                  .|| .:|..| .|.|.|     ::..:|.|:          |||
  Rat    80 IYNPTMGVSVLPPYEKRVEFLRPS-FIDGTIRLSHLEL-----EDEGMYICE----------FAT 128

  Fly   535 KTLGVHFPPETVKISVVPKNLVPGIRAKL-------------ICDSSSSNPPAKISW---WKDGI 583
            ...|.......:.:...|.|.:.|.:|.|             .|.|::..||:.:||   .|...
  Rat   129 FPTGNRESQLNLTVMAKPTNWIEGTQAVLRARKGQDDKVLVATCTSANGKPPSVVSWETRLKGEA 193

  Fly   584 PVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVH-------ETISLDIL 641
            ..:.:...|      |:|:.:..|        .:|.:.::|.:.|...|:       |:::|::.
  Rat   194 EYQEIRNPN------GTVTVISRY--------RLVPSREAHRQSLACIVNYHLDRFRESLTLNVQ 244

  Fly   642 YPPKFETPQSTTFVGVEGAPF----HVELL--ASGNPMVITYTWT--KDGLPISSNSLSGQRLIS 698
            |.|:      .|..|.:|..:    .|:|.  |..||....|.||  ...|| .......:.|..
  Rat   245 YEPE------VTIEGFDGNWYLQRTDVKLTCKADANPPATEYHWTTLNGSLP-KGVEAQNRTLFF 302

  Fly   699 DGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGE 754
            .|| :|.|.     ||.|||||.|..||...:::|.:...|.......||.  ||:
  Rat   303 RGP-INYSL-----AGTYICEATNPIGTRSGQVEVNITEFPYTPTPEHGRR--AGQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353
Ig 162..232 CDD:472250
Ig strand B 162..167 CDD:409353
Ig strand C 177..181 CDD:409353
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand F 320..325 CDD:409353
Ig strand G 335..338 CDD:409353
Ig 343..431 CDD:472250
Ig strand B 363..367 CDD:409353
Ig strand C 377..381 CDD:409353
Ig strand E 406..410 CDD:409353
Ig strand F 420..425 CDD:409353
Ig 443..527 CDD:472250 25/114 (22%)
Ig strand B 466..470 CDD:409353 1/3 (33%)
Ig strand C 480..484 CDD:409353 1/8 (13%)
Ig strand E 503..507 CDD:409353 2/3 (67%)
Ig strand F 517..522 CDD:409353 2/4 (50%)
Ig 554..640 CDD:472250 21/108 (19%)
Ig strand B 561..565 CDD:409353 2/16 (13%)
Ig strand C 575..579 CDD:409353 2/6 (33%)
Ig strand E 602..608 CDD:409353 0/5 (0%)
Ig strand F 618..623 CDD:409353 1/4 (25%)
Ig strand G 633..636 CDD:409353 1/9 (11%)
Ig_3 643..722 CDD:464046 26/86 (30%)
Ig 748..829 CDD:472250 3/7 (43%)
Ig strand B 756..760 CDD:409353
Ig strand C 769..775 CDD:409353
Ig strand E 792..798 CDD:409353
Ig strand F 808..813 CDD:409353
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
Nectin1NP_001093946.1 IgV_1_Nectin-1_like 31..143 CDD:409469 30/139 (22%)
FR1 31..54 CDD:409469 7/32 (22%)
Ig strand A 31..35 CDD:409469 1/3 (33%)
Ig strand A' 37..41 CDD:409469 1/6 (17%)
Ig strand B 46..54 CDD:409469 4/14 (29%)
CDR1 55..62 CDD:409469 4/6 (67%)
FR2 63..69 CDD:409469 1/5 (20%)
Ig strand C 64..69 CDD:409469 1/4 (25%)
CDR2 70..89 CDD:409469 3/18 (17%)
Ig strand C' 79..84 CDD:409469 2/4 (50%)
Ig strand C' 86..90 CDD:409469 0/3 (0%)
FR3 90..128 CDD:409469 10/53 (19%)
Ig strand D 97..101 CDD:409469 0/3 (0%)
Ig strand E 106..113 CDD:409469 2/6 (33%)
Ig strand F 120..128 CDD:409469 3/17 (18%)
CDR3 129..132 CDD:409469 0/2 (0%)
Ig strand G 132..142 CDD:409469 1/9 (11%)
FR4 133..143 CDD:409469 0/9 (0%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 22/110 (20%)
Ig strand A 146..152 CDD:143298 2/5 (40%)
Ig strand B 168..175 CDD:143298 1/6 (17%)
Ig strand C 180..186 CDD:143298 2/5 (40%)
Ig strand C' 188..190 CDD:143298 0/1 (0%)
Ig strand D 191..199 CDD:143298 0/7 (0%)
Ig strand E 205..213 CDD:143298 2/15 (13%)
Ig strand F 223..230 CDD:143298 2/6 (33%)
Ig strand G 234..240 CDD:143298 1/5 (20%)
Ig 247..333 CDD:472250 30/98 (31%)
Ig strand B 265..269 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 3/4 (75%)
Ig strand G 330..333 CDD:409353 1/2 (50%)
TM_EGFR-like 353..382 CDD:213052
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.