DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and Alcam

DIOPT Version :10

Sequence 1:NP_788355.1 Gene:hbs / 44129 FlyBaseID:FBgn0287864 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_033785.1 Gene:Alcam / 11658 MGIID:1313266 Length:583 Species:Mus musculus


Alignment Length:509 Identity:122/509 - (23%)
Similarity:196/509 - (38%) Gaps:106/509 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 GDSVQLSC-VTAPSNPQARISWSI---NGRPL----DNSTYKTTSSSD-----GGWVSSSNISLT 411
            ||::.:.| :..|.|.... .|..   :|.|:    .:||.|:....|     .....|.|.:|:
Mouse    36 GDTIVMPCRLDVPQNLMFG-KWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLS 99

  Fly   412 ID----SQSRTFIAVCHALNTELTQNVVGSHT-VNVLYPPSPPLLTGYNDGDILISGSILKL-QC 470
            |.    |..:.|:.:   |.||  .||..:.| |.|...||.|.:.  |....|.:..:.|| .|
Mouse   100 IANAKISDEKRFVCM---LVTE--DNVFEAPTLVKVFKQPSKPEIV--NKAPFLETDQLKKLGDC 157

  Fly   471 SSAGGNPPPTLQWYKNDKIINAP--------SKLVDS-----KITSELSLLVNASDNNAIYKCKV 522
            .|....|...:.||:|.|::...        .|.:|.     .:||.|......||....:.|.|
Mouse   158 ISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSV 222

  Fly   523 QNAAIDIPLFATKTL-------GVHFPPETVKISVV-PKNLV-PGIRAKLICDSSSSNPPAKISW 578
            ......    ..||:       .:::|.|.|.|.|: |||.: .|....|.|..:.:.||.:..:
Mouse   223 TYYGPS----GQKTIYSEQEIFDIYYPTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMF 283

  Fly   579 WKDGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETIS---LDI 640
            :..|.| ||:..:|       :.:..::..|.|.|     |.| |..:....:...||:   ||:
Mouse   284 YLPGQP-EGIRSSN-------TYTLTDVRRNATGD-----YKC-SLIDKRNMAASTTITVHYLDL 334

  Fly   641 LYPPKFETPQSTTFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNI 705
            ...|..|.   |..:| :..|....:.||.|..|:   |.||.:.:.|:.             :.
Mouse   335 SLNPSGEV---TKQIG-DTLPVSCTISASRNATVV---WMKDNIRLRSSP-------------SF 379

  Fly   706 SRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFV--------AGEPAVLACHI 762
            |.|...|||.|:||      |||.|:: .::...::|.:.||:..:        :|....:.||:
Mouse   380 SSLHYQDAGNYVCE------TALQEVE-GLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHV 437

  Fly   763 QARPLEAAHVRWSRDGYDLATRTISSFENGTALLQIASVERSDIGNFTCIVDNQ 816
            :..|..|.|...:..|..:.....|.:.||....:|......:: ..||..:||
Mouse   438 EGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENV-TLTCTAENQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_788355.1 IG_like 45..137 CDD:214653
Ig strand B 56..60 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 91..105 CDD:409353
Ig strand F 115..120 CDD:409353
Ig strand G 128..131 CDD:409353
Ig 162..232 CDD:472250
Ig strand B 162..167 CDD:409353
Ig strand C 177..181 CDD:409353
Ig strand E 207..211 CDD:409353
Ig strand F 221..226 CDD:409353
Ig 246..342 CDD:472250
Ig strand B 269..273 CDD:409353
Ig strand C 283..287 CDD:409353
Ig strand F 320..325 CDD:409353
Ig strand G 335..338 CDD:409353
Ig 343..431 CDD:472250 21/87 (24%)
Ig strand B 363..367 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 406..410 CDD:409353 1/3 (33%)
Ig strand F 420..425 CDD:409353 0/4 (0%)
Ig 443..527 CDD:472250 23/97 (24%)
Ig strand B 466..470 CDD:409353 2/4 (50%)
Ig strand C 480..484 CDD:409353 0/3 (0%)
Ig strand E 503..507 CDD:409353 2/3 (67%)
Ig strand F 517..522 CDD:409353 1/4 (25%)
Ig 554..640 CDD:472250 20/89 (22%)
Ig strand B 561..565 CDD:409353 1/3 (33%)
Ig strand C 575..579 CDD:409353 0/3 (0%)
Ig strand E 602..608 CDD:409353 0/5 (0%)
Ig strand F 618..623 CDD:409353 2/4 (50%)
Ig strand G 633..636 CDD:409353 0/2 (0%)
Ig_3 643..722 CDD:464046 21/78 (27%)
Ig 748..829 CDD:472250 15/77 (19%)
Ig strand B 756..760 CDD:409353 0/3 (0%)
Ig strand C 769..775 CDD:409353 2/5 (40%)
Ig strand E 792..798 CDD:409353 1/5 (20%)
Ig strand F 808..813 CDD:409353 2/4 (50%)
Ig strand G 822..825 CDD:409353
Ig_3 833..918 CDD:464046
FN3 <932..1151 CDD:442628
FN3 935..1017 CDD:238020
AlcamNP_033785.1 Ig 29..117 CDD:472250 19/84 (23%)
Ig strand B 39..43 CDD:409329 0/3 (0%)
Ig strand C 55..59 CDD:409329 1/3 (33%)
Ig strand E 96..100 CDD:409329 1/3 (33%)
Ig strand F 110..115 CDD:409329 1/7 (14%)
C2-set_2 137..231 CDD:400489 21/99 (21%)
Ig strand B 151..157 CDD:409353 2/5 (40%)
Ig strand C 167..171 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
IG_like 255..329 CDD:214653 21/87 (24%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 1/10 (10%)
Ig strand F 310..315 CDD:409353 3/10 (30%)
IG_like 339..393 CDD:214653 18/73 (25%)
Ig_3 415..489 CDD:464046 13/74 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..583
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.