DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbs and nphs1

DIOPT Version :9

Sequence 1:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_031761552.1 Gene:nphs1 / 100494620 XenbaseID:XB-GENE-487811 Length:1236 Species:Xenopus tropicalis


Alignment Length:1199 Identity:359/1199 - (29%)
Similarity:558/1199 - (46%) Gaps:100/1199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNL 103
            |.|.:.|.::.:::|:..||.|||.:..|.|||.|:|..||....||||.|||:..|..:..|||
 Frog    24 QVFRVQPDNITVVQGSTALLSCEVEHGTGMVQWEKNGLLLGPDRNIPGFLRYSMTGDPHKGEYNL 88

  Fly   104 QIKNATLEDDAEYQCQVGPA-AGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHC 167
            :|:.:.|:|||||.||||.: .....|...|.::::..|.:...|.||..:||........|:.|
 Frog    89 RIERSELDDDAEYHCQVGRSEVSLGIISRTALINVLIPPKAPTFEEYAAGSRVTWVYGVEYTVTC 153

  Fly   168 IAENANPAAEIVWFQGEVPV----STAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARH 228
            .|.:|.|||.:...:..:.|    |:.|     .:..|...|:....:.|::.|:.|..:|.|.:
 Frog   154 QATDAKPAAALTIKKSGLEVSGDSSSNP-----GSRDKLENTAMVAKVIPQSSDNGKLLTCLALN 213

  Fly   229 KALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNGVAI 293
            .||  ..|:.....::||:||.||..|||. |.::..|:.:::.|.|..|||.|.|.|.:|...:
 Frog   214 PAL--QTPITVSFTMNVLFPPNAPIIEGYI-GPSVKAGETLKLICISLSGNPLATLQWSKNDDVV 275

  Fly   294 SSPQRTSG--RLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGANQ 356
            |:...|..  |.|.:.........||.|.:.|||.|.:....|:..:.|.|::.|.:|.:.|::.
 Frog   276 STRWETDEVVRASRSHLTLNIKPADNMAVVSCEAVNHVTPETLKTSIILNVVFLPTEVTILGSSS 340

  Fly   357 AKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFIA 421
            .....::..||.||.|||..:|.|.:..:.|.|:....:.:..||.|:.||:::....:......
 Frog   341 GPEKSNLTFSCFTAASNPPVQIRWWLGPKELVNTIVTISDAVHGGKVTMSNLTMEALREEHGMAL 405

  Fly   422 VCHALNTELTQNVVGSHTVNVLYPP------SPPLLTGYNDGDILISGSILKLQCSSAGGNPPPT 480
            .|.|.|..:......|.|::|.|||      :||.      .....:|:.:|:.|.|:||||||.
 Frog   406 TCEAFNEAILYTKSNSVTLSVQYPPQNVWIEAPPA------DKFFRAGTSVKMTCFSSGGNPPPR 464

  Fly   481 LQWYKNDKIINAPSKLVDSKI-TSELSLLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVHFPPE 544
            |.|.|:.|.::..|::...|| |.|::::...|||.|.|:|...|......|.|:..|.|.||..
 Frog   465 LTWIKDTKSLSGGSQIHSGKIVTKEITIITVPSDNMATYRCNASNIGKTPALTASTKLKVQFPAI 529

  Fly   545 TVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNLANRPGLWGGSVSTLEMYVN 609
            .|.|....|....|....|.|.:.||||.:.|||.|||..::..:|..:|.|:||..|:..:.:.
 Frog   530 DVNIISSAKEYRRGSTIILTCVTGSSNPASTISWVKDGEQLKAQDLGRKPSLYGGISSSSRVTLK 594

  Fly   610 ITQDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVELLASGNPMV 674
            .....:|...:|::.:.||..:|:....|:||:||:|...|......||.....:.:....||..
 Frog   595 AASKDNGRRVSCEAFSSVLNEAVNTFYKLNILFPPEFLDDQPAVVQAVEHGAALIPVRVRANPPQ 659

  Fly   675 ITYTWTKDGLPISSNSLSGQRLISDGP---------RLNISRLSRNDAGVYICEALNSQGTALLE 730
            |.|||          ||.|::||.||.         .|.|..:||.|:|||....:|.:|...:.
 Frog   660 INYTW----------SLWGEKLIRDGAYRHHLRGEGALEIWNVSRADSGVYNVTCVNKEGKNSIV 714

  Fly   731 IQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDGYDLATRTISSFENGT-- 793
            |::.|:|:|||.::.: .....|..|.:||...|.|...:..:|...|.:  .|.:|:.|...  
 Frog   715 IRLDVQYSPTIRSLGD-TEVDLGSDAEIACTADANPATDSMFQWRWLGDE--ERDLSALERKVDG 776

  Fly   794 --ALLQIASVERSDIGNFTCIVDNQRGAPAA--QNVLLVVQTAPEIDHSPGFTRYAARLGVR--A 852
              ..|.|...:|:|.|.:.|.|||  |.|.:  .:..|:|:..|:|......::.|.....:  |
 Frog   777 VIGRLVIREAKRTDAGRYECTVDN--GIPPSIKADARLIVRFKPDIHKGVHLSKVAVPGDGKSVA 839

  Fly   853 QLICRSLASPQPSFIWRRHG--KDLKMQRRNKFKSVERQVDALNFESALLIENTSP-DDYGQYEC 914
            .|:|::...|..:|.|.::|  .|||..|.::....|..|..    |.|:|.|.|. .||..:.|
 Frog   840 ALVCKAEGIPSVAFSWAKNGVSLDLKDPRYSEKTFHELSVHT----STLVISNVSAVKDYALFTC 900

  Fly   915 VVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRLKQHGEDKY 979
            ...|:||..|.|::....||||.|..|||...:...|.|.|:.|||||.:..||:|.:..|.|.:
 Frog   901 TATNTLGVDSFTIQLVSTSRPDPPSGLRVIGFTHNSVTLQWSAGFDGGAEQKFRVRYRWPGTDSH 965

  Fly   980 KYVDAKPGHQNI-SLDGLKPGATYYFSVMAANEAGGSKFMPD---IKLTLSKGS-------QPHS 1033
            .|||..|..:.: ::.|||....|.|||.|.|..|.|.:...   :.:|..:.:       ||..
 Frog   966 MYVDVFPPQETVFTITGLKGSTAYNFSVNAINALGESDYADQGAVVSVTTKETTLLPVPTQQPTR 1030

  Fly  1034 AEYTEKDELPNVMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAEPSNDDVYSKDDSQSVYK 1098
            |...|..|.|..::..:.:...:|||.|||.:...|.|.::|||      ..:...||:||.   
 Frog  1031 APTAEALEWPPYILAAVCAGGALLLVSNAAFIGCLVKRSRDKSQ------GGEGVKKDESQQ--- 1086

  Fly  1099 LPITAL----QADVQKKAAASTYLVENVDIIQSTAYPPKYQESSMCTPPYPLCNPDFTRTLPNPK 1159
               .||    ..::....|..|.|:::.....|:.|.....||.:..  ||:  .|:..:| :|:
 Frog  1087 ---RALNEYGDGELINTHAKKTLLIDSGSETGSSLYQDSASESGIYY--YPV--RDYRPSL-SPQ 1143

  Fly  1160 RHSQRNSATGMIEGMQMRSKDDHMLISNG 1188
            ........:| |.|.:....:|....|.|
 Frog  1144 YEVPERGESG-IRGWEEGGYEDWYSTSEG 1171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbsNP_001286439.1 Ig 44..122 CDD:299845 36/77 (47%)
IG_like 45..137 CDD:214653 39/92 (42%)
Ig 153..231 CDD:299845 19/81 (23%)
IG_like 258..342 CDD:214653 24/85 (28%)
Ig 266..327 CDD:299845 20/62 (32%)
IG_like 357..>414 CDD:214653 16/56 (29%)
Ig 360..427 CDD:299845 18/66 (27%)
Ig <468..526 CDD:299845 24/58 (41%)
I-set 547..633 CDD:254352 25/85 (29%)
Ig 556..631 CDD:299845 23/74 (31%)
I-set 644..735 CDD:254352 29/99 (29%)
IGc2 668..725 CDD:197706 22/65 (34%)
IG_like 751..829 CDD:214653 23/83 (28%)
IGc2 753..815 CDD:197706 18/65 (28%)
Ig 852..928 CDD:143165 26/78 (33%)
FN3 935..1017 CDD:238020 34/82 (41%)
nphs1XP_031761552.1 Ig 25..105 CDD:416386 35/79 (44%)
Ig strand A 25..28 CDD:409353 1/2 (50%)
Ig strand A' 32..35 CDD:409353 0/2 (0%)
Ig strand B 41..51 CDD:409353 5/9 (56%)
Ig strand C 53..58 CDD:409353 3/4 (75%)
Ig strand C' 60..62 CDD:409353 1/1 (100%)
Ig strand D 82..86 CDD:409353 0/3 (0%)
Ig strand F 99..108 CDD:409353 7/8 (88%)
Ig strand G 113..123 CDD:409353 2/9 (22%)
Ig 138..228 CDD:416386 22/96 (23%)
Ig strand A' 139..143 CDD:409353 2/3 (67%)
Ig strand B 150..157 CDD:409353 3/6 (50%)
Ig strand C 162..167 CDD:409353 1/4 (25%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand D 175..182 CDD:409353 2/11 (18%)
Ig strand E 188..196 CDD:409353 1/7 (14%)
Ig strand F 205..213 CDD:409353 3/7 (43%)
Ig strand G 219..225 CDD:409353 1/5 (20%)
Ig 229..326 CDD:416386 32/97 (33%)
Ig strand A 229..232 CDD:409353 1/2 (50%)
Ig strand A' 235..239 CDD:409353 1/3 (33%)
Ig strand B 249..259 CDD:409353 2/9 (22%)
Ig strand C 262..271 CDD:409353 4/8 (50%)
Ig strand D 273..280 CDD:409353 1/6 (17%)
Ig strand E 285..295 CDD:409353 2/9 (22%)
Ig strand F 303..312 CDD:409353 4/8 (50%)
Ig strand G 318..325 CDD:409353 1/6 (17%)
Ig 332..413 CDD:416386 21/80 (26%)
Ig strand A' 333..337 CDD:409353 1/3 (33%)
Ig strand B 345..355 CDD:409353 3/9 (33%)
Ig strand C 358..367 CDD:409353 3/8 (38%)
Ig strand C' 368..371 CDD:409353 0/2 (0%)
Ig strand D 374..381 CDD:409353 0/6 (0%)
Ig strand E 386..395 CDD:409353 3/8 (38%)
Ig strand F 403..411 CDD:409353 2/7 (29%)
Ig_3 429..509 CDD:404760 29/85 (34%)
Ig strand B 449..458 CDD:409353 3/8 (38%)
Ig strand C 464..469 CDD:409353 2/4 (50%)
Ig strand C' 472..474 CDD:409353 1/1 (100%)
Ig strand D 483..486 CDD:409353 1/2 (50%)
Ig strand F 502..509 CDD:409353 2/6 (33%)
Ig strand G 514..524 CDD:409353 3/9 (33%)
Ig 541..618 CDD:416386 23/76 (30%)
Ig strand B 544..554 CDD:409353 2/9 (22%)
Ig strand C 557..566 CDD:409353 4/8 (50%)
Ig strand C' 567..570 CDD:409353 1/2 (50%)
Ig strand D 572..579 CDD:409353 1/6 (17%)
Ig strand E 584..594 CDD:409353 2/9 (22%)
Ig strand F 602..614 CDD:409353 2/11 (18%)
Ig <652..719 CDD:416386 24/76 (32%)
Ig strand C 659..667 CDD:409353 5/17 (29%)
Ig strand C' 668..671 CDD:409353 1/2 (50%)
Ig strand D 677..683 CDD:409353 0/5 (0%)
Ig strand E 686..694 CDD:409353 2/7 (29%)
Ig strand F 698..706 CDD:409353 3/7 (43%)
Ig strand G 708..719 CDD:409353 2/10 (20%)
Ig_3 723..800 CDD:404760 21/79 (27%)
Ig strand B 739..743 CDD:409353 1/3 (33%)
Ig strand C 752..758 CDD:409353 0/5 (0%)
Ig strand E 779..783 CDD:409353 1/3 (33%)
Ig strand F 793..798 CDD:409353 1/4 (25%)
Ig strand G 807..810 CDD:409353 0/2 (0%)
Ig 814..922 CDD:416386 32/111 (29%)
putative Ig strand A 819..824 CDD:409353 1/4 (25%)
putative Ig strand B 839..846 CDD:409353 3/6 (50%)
putative Ig strand C 850..856 CDD:409353 1/5 (20%)
putative Ig strand C' 859..861 CDD:409353 1/1 (100%)
putative Ig strand D 868..871 CDD:409353 1/2 (50%)
putative Ig strand E 878..886 CDD:409353 3/11 (27%)
putative Ig strand F 897..904 CDD:409353 1/6 (17%)
putative Ig strand G 919..922 CDD:409353 2/2 (100%)
FN3 921..1015 CDD:238020 34/93 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.