DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and MAB21L4

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001078906.3 Gene:MAB21L4 / 79919 HGNCID:26216 Length:447 Species:Homo sapiens


Alignment Length:403 Identity:84/403 - (20%)
Similarity:148/403 - (36%) Gaps:74/403 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VPSDMIAAQSKMVYQMNKYCADRVQVRKAQIHKQIQEVCRIVQDVLKEVEVQEPRFISSLNDYNG 67
            :|:..:|.|..:.:    :....::.|:|...:..|....::..||:.|...:||||.   ||: 
Human     6 LPTSAMAVQVPLWH----HYLQAIRSREAPRAQDFQRAENVLLTVLERVHALDPRFIV---DYS- 62

  Fly    68 RFEGLEVI--------SPTEFEIIIYLNQMGVLNFVDDGTLP--GCAVLKLSDGRK-RSMSLWV- 120
              .|||..        .|.:.|:.::::...:|....:.|.|  |..:..|...|: ..:..|. 
Human    63 --RGLEAFQFALRSSEDPMDMEVPLWVDAEALLIEEPEATQPEDGLELCHLGVPREGAGLERWTT 125

  Fly   121 -EFITAS--------GYLSARKIRSRFQTLVAQACDKCAYRDIVK----MIADTTEVKLRIR--- 169
             :..|||        |::...|:....:.|:..|...|.:..::.    ..|...|.:|.:.   
Human   126 EDTFTASSEGDAKCRGHIVPSKVLCVLKDLLVAAIVHCKHHSLIAPGSLNAASLREEQLHLSLLV 190

  Fly   170 ----ERIIVQITPAFKCAGLWPRSASHWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQGKNSA 230
                ..|...:.|..:.....|.......:||.|   ...:..:.::|.|::            .
Human   191 SSGWRTISFHVVPVVRRKLGAPALEGVQQMPGFP---EGSLRRILSQGVDLV------------P 240

  Fly   231 MEGDAWVLSFTDAENRL------LQGASRRRCLSILKTLRDRHLDLPG--NPVTSYHLKTLLLYE 287
            .....|..|......||      ||| .|...||||..:........|  :.:|..|||.:||:.
Human   241 ASAQLWRTSTDYLLTRLLGELGSLQG-HRLDSLSILDRVNHESWRDSGQTDGLTFGHLKMVLLWA 304

  Fly   288 CEKHPREMEWEENCIADRINGIFLQLISCLQCRRCPHYFLPNMDLFKGK--SPGAL----ENAAK 346
            ........:|.|  :...:..:.:.|:.||..|:.||:..|..:|.:|.  ..||:    |..|.
Human   305 SVLFLAPEDWAE--LQGAVYRLLVVLLCCLATRKLPHFLHPQRNLLQGSGLDLGAIYQRVEGFAS 367

  Fly   347 QVWRLTRIMLTNV 359
            |.....||..|::
Human   368 QPEAALRIHATHL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 66/327 (20%)
MAB21L4NP_001078906.3 Mab-21 143..363 CDD:367433 47/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.