DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and Cgas

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_038938458.1 Gene:Cgas / 682147 RGDID:1586939 Length:510 Species:Rattus norvegicus


Alignment Length:354 Identity:85/354 - (24%)
Similarity:154/354 - (43%) Gaps:68/354 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYCADRVQVRKAQIHKQIQEVCRIVQDVLKEVEVQEPRF--ISSLNDYNGRFEGLEVISPTEFEI 82
            |...|::::::.:|....:.|.::|..:|:.::.:|..|  :..||. ...:|.:::.:|.||::
  Rat   154 KKVLDKLRLKRKEISAAAETVNKVVDQLLRRMQRRESEFKGVEQLNT-GSYYEHVKISAPNEFDV 217

  Fly    83 IIYLN--QMGVLNFVDDGTLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQA 145
            :..|.  ::.:..:.:.|........::..|...|..|..|      .|||.|:.|:|:.|:   
  Rat   218 MFKLEVPRIELEEYYETGAFYRVKFKRIPRGNPLSHFLEGE------VLSATKVLSKFRELI--- 273

  Fly   146 CDKCAYRDIVKMIADT-----------TEVKLRIR--ERIIVQITPAFKCAGLWPRSASHWPLPG 197
                  ::.||.|.||           ..|.|.||  |.|.|.|..|.:..|.||.|..    .|
  Rat   274 ------KEEVKEIKDTDVTVEEEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTK----GG 328

  Fly   198 IP---WPHPNIVAEVKTEGFDMLSKECIALQGKNSAMEGDAWVLSFTDAENRLL----------- 248
            :|   |....:...::.|.|.::.|.  |..|  :..:|:.|.|||:..|..:|           
  Rat   329 LPIQDWLGTKVRTNLRREPFYLVPKN--AKDG--NRFQGETWRLSFSHTEKYILNNHGIGKTCCE 389

  Fly   249 -QGAS--RRRCLSILKTLRD------RHLDLPGNPVTSYHLKTLLLYECEKHPREMEWEENCIAD 304
             .||.  |:.||.::|.|.:      :.||    ...|||:||.:.:...|.|::.:|:...::.
  Rat   390 SSGAKCCRKECLKLMKYLLEQLKREFQELD----AFCSYHVKTAIFHMWTKDPQDSQWDPRNLST 450

  Fly   305 RINGIFLQLISCLQCRRCPHYFLPNMDLF 333
            ..:......:.||:..:..|||:|..:||
  Rat   451 CFDKFLTFFLECLRTEKLDHYFIPKFNLF 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 75/304 (25%)
CgasXP_038938458.1 PHA03247 <2..143 CDD:223021
Mab-21 203..498 CDD:397398 75/304 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.