DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and Mab21l4

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001102781.1 Gene:Mab21l4 / 501185 RGDID:1563692 Length:452 Species:Rattus norvegicus


Alignment Length:383 Identity:79/383 - (20%)
Similarity:140/383 - (36%) Gaps:76/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VQVRKAQIHKQIQEVCRIVQDVLKEVEVQEPRFISSLNDYNGRFEGLEVI-----SPTEFEIIIY 85
            :|.|::...:..|....|:..||:.....:.|||.   ||:...|..:..     .|.:.|:::.
  Rat    30 IQSRESPRVQDYQRAENILLTVLERAHALDSRFIV---DYSRDLEAFQFALRSSEDPLDVEVLLG 91

  Fly    86 LNQMGVLNFVDDGTLPG-----C--AVLKLSDGRKRSMSLWV----------EFITASGYLSARK 133
            ::...:|....:.:.||     |  .|||.:.|    :..|:          :....||::...|
  Rat    92 VDSEALLIEESEASEPGDGPAICRLGVLKEASG----LGPWMTDDIFSVSSEDRDKCSGHIIPGK 152

  Fly   134 IRSRFQTLVAQACDKCAYRDIV--------KMIADTTEVKLRIR---ERIIVQITPAFKCAGLWP 187
            :....:.|:..|...|.:..::        .:......:.|::.   .:|...:.|..|.....|
  Rat   153 VLCVLKDLLVAAIVHCKHHRLIPPGSLNAASLKGGQMRLSLQVSSGWRKIRFNVVPVVKKKHRVP 217

  Fly   188 RSASHWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQGKNSAMEGDAWVLSFTDAENRLLQG-- 250
              |....|..:.:|. .|:..:.:.|.|::            ......|.:|.....:|||..  
  Rat   218 --ALEGALLKLGFPE-GILRRIASHGVDLV------------PANAQHWRISTGYLLSRLLDALG 267

  Fly   251 ---ASRRRCLSILK--TLRDRHLDLPGNPVTSYHLKTLLLYECEKHPREMEWEENCIADRINGIF 310
               ..|...||||.  .|.........:.:|..||||:||:.....|...:|     ||....::
  Rat   268 SLPGHRLDSLSILDRVNLESWRGGSQNHGLTFDHLKTVLLWASTLFPAPEDW-----ADLQGSVY 327

  Fly   311 LQLI---SCLQCRRCPHYFLPNMDLFK--GKSPGAL----ENAAKQVWRLTRIMLTNV 359
            .||:   .||..|..||:..|..:|.:  |...|.:    |:.|.|.....||.:|::
  Rat   328 RQLVVLLCCLATRNLPHFLYPECNLLQDSGLDLGIIYQQVEHFASQPEESLRIHVTHL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 65/330 (20%)
Mab21l4NP_001102781.1 Mab-21 144..369 CDD:281298 50/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.