DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and CG7194

DIOPT Version :10

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_648203.1 Gene:CG7194 / 38933 FlyBaseID:FBgn0035868 Length:346 Species:Drosophila melanogaster


Alignment Length:33 Identity:9/33 - (27%)
Similarity:16/33 - (48%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 AYPMTIPGCQQICP--YSQFLQLLENVRVRSLD 351
            ||..|:.......|  |..|:.:::|.:.|.:|
  Fly    17 AYIRTVKSTFHNDPDKYDDFMAIMKNFKARKID 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..250 CDD:460873
Mab-21_C 253..350 CDD:466416 8/30 (27%)
CG7194NP_648203.1 Mab-21 59..225 CDD:460873
Mab-21_C 228..312 CDD:466416
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.