DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and CG15865

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_573143.1 Gene:CG15865 / 32641 FlyBaseID:FBgn0015336 Length:1084 Species:Drosophila melanogaster


Alignment Length:246 Identity:51/246 - (20%)
Similarity:88/246 - (35%) Gaps:62/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YLSARKIRSRF----------QTLVAQA-CDKCAYRDIVKMIADTTEVKLRIRERIIVQITPAFK 181
            |||:::....|          |..::|: ...|:||......|         ||.::    ||..
  Fly   427 YLSSQQFMLYFGEVLRHHLANQLGISQSQLAACSYRGCSVYTA---------REELV----PAIH 478

  Fly   182 CAGLWPRSASHWPLPGIP------------WPHPNIVAEVKTEGFDMLSKECIALQGKNSAMEGD 234
            ....||..|..:.|...|            ||...:...:::.||.::.......:.:|...|.:
  Fly   479 VPNSWPDCAFEFWLRARPRLTNLHTAEQFQWPTEQMKKRIRSMGFHVVPVGYAPKRSRNPFRELE 543

  Fly   235 AWVLSFTDAENRLLQGASRRRCLS------------ILKTLRDRHL----DLPGNPVTSYHLKTL 283
             |.:.|..||..|     .|.||:            ::||..|...    ..||  .....|:..
  Fly   544 -WRIVFPQAEQFL-----ERHCLTPMQLKVFQLMKLLVKTFVDESTTSCDQSPG--ALLEQLRAH 600

  Fly   284 LLYECEKHPREMEWEENCIADRINGIFLQLISCLQCRRCPHYFLPNMDLFK 334
            :.::||:|..  :|.|..:.:|:........:||..:....||:...:||:
  Fly   601 MFWQCEQHSN--DWPEEFLGERLVRFIRSFDACLAKKHLSDYFIERRNLFE 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 51/246 (21%)
CG15865NP_573143.1 Mab-21 <472..656 CDD:281298 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.