DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and Mab21l3

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001099926.1 Gene:Mab21l3 / 295326 RGDID:1308694 Length:429 Species:Rattus norvegicus


Alignment Length:367 Identity:94/367 - (25%)
Similarity:167/367 - (45%) Gaps:75/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RVQVRKAQIHKQIQEVCRIVQDVLKEVEVQEPRF--ISSLNDYNGRFEGLEVISPTEFEIIIYLN 87
            ::.:|:.||.:.::||.:||..:..|:...:.||  :.:.:.||   :.::|::|:.|.:.:.|.
  Rat    83 KMDLRQQQISQTVEEVQKIVHLLTTEISHHDSRFEAVPASDTYN---DSIKVLAPSLFHVTVPLR 144

  Fly    88 QM----GVLN-----FVDDGTLPGCAVLKLSDGRKRSMSLWVEF--------------ITASGYL 129
            .:    ||..     :...||...|. |:..:|    :..|:|.              :...|.:
  Rat   145 GLAGYKGVRTPRWRYYSLQGTKLSCP-LRDPEG----LQQWLETETFMKTLWQWHKVDVNIEGDI 204

  Fly   130 SARKIRSRFQTLVAQACDKCAYRDIVKMIADTTEVKLRIRE---RIIVQITPAFKCAGLWPRSAS 191
            ...|:...||.||..|...|.....|.::...|.|.:.:..   ::.:::.|..:....||..| 
  Rat   205 VPAKVLQIFQMLVENAVRTCHLSGKVTVLEKRTTVWVAVETSTGQVELELAPTVEIPTTWPEKA- 268

  Fly   192 HWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQGKNSAMEGDAWVLSFTDAENRLLQ-----GA 251
            .||.....||.|..|..:|:.||:::::...            .|.|||:.||..|.:     |.
  Rat   269 QWPRCLKRWPSPERVECIKSFGFNLVAQSTY------------HWQLSFSQAERVLCEQLDEDGG 321

  Fly   252 SRRRCLSILKTLRDRHLDL--PG-NPV-TSYHLKTLLLYECEKHPREMEWEENCIADRINGIFLQ 312
            .||||..:|:.|::   |:  || .|| |::||:|:|.:.|||:|...:|:.      .:..||:
  Rat   322 CRRRCFQVLRQLKE---DVWCPGRRPVITTHHLQTVLFWTCEKYPHLKDWQV------FHQAFLR 377

  Fly   313 LISCLQCRRC------PHYFLPNMDLFKGKSPGALENAAKQV 348
            |:..|  .||      .|||:|..:||:..:|..|:..|::|
  Rat   378 LVRKL--HRCVSQHFLKHYFVPKSNLFQSANPSELDAVAQKV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 82/322 (25%)
Mab21l3NP_001099926.1 Mab-21 125..418 CDD:281298 84/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.