DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and CG30424

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster


Alignment Length:278 Identity:57/278 - (20%)
Similarity:98/278 - (35%) Gaps:94/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LEVISPTEFEIII-----YLNQMGVLNFVDDGTLPGCAVLKLS------------DGRKRSMSLW 119
            |::..|.||:::.     |...:.|..   |..:||..:|.::            |.::....:.
  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAVTR---DPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63

  Fly   120 VEFITASGYLSARKIRSRFQTLVAQACDKCAYRDIVKMIADTTEVKLRIRE-------------R 171
            ...:.|..:....::||..|:|.:||.::.:||  |:::|.... .|:.|.             .
  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVS-HLKYRTCGPAHTIYVYGDYE 125

  Fly   172 IIVQITPA-----------------FKCAGLWPRSASHW---PLPGIPWPHPNIVAEVKTEGFDM 216
            ..|...||                 ||.|     :.|:|   |.|..|....:::          
  Fly   126 YSVDYVPAICLAAEQNVLPTKQLECFKRA-----NTSYWEAIPKPLKPLTETSMI---------- 175

  Fly   217 LSKECIALQGKNSAMEGDAWVLSFTDAENRLLQGASR--RRCLSILKTLRDRHLDLPGNPVTSYH 279
                              ::..||...|..|||....  |..:..:|..||...:| || ..||:
  Fly   176 ------------------SFRSSFYAVEKILLQDVHENCRNAIRFMKKFRDVKTNL-GN-CKSYY 220

  Fly   280 LKTLLLYECEKHPREMEW 297
            :|||.|::..:.| |..|
  Fly   221 IKTLFLWKIIQEP-ESYW 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 57/278 (21%)
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 57/278 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.