DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and MB21D2

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_848591.2 Gene:MB21D2 / 151963 HGNCID:30438 Length:491 Species:Homo sapiens


Alignment Length:402 Identity:91/402 - (22%)
Similarity:160/402 - (39%) Gaps:91/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RVQVRKAQIHKQIQEVCRIVQ---DVLKEVEVQEPR-FISSL--------------NDY----NG 67
            |...|..:::|.|||..:..|   |..:.:|:...: ||.|:              |:|    .|
Human    28 RSGARVEELNKLIQEFTKHDQREYDDQRALEIHTAKDFIFSMLGMVQKLDQKLPVANEYLLLSGG 92

  Fly    68 RFEG--------LEVIS-PTEFEIIIYL----------NQMGVLNFVDDGTLPGCAVLKLSDGRK 113
            ..||        |.|.: .|::::...|          ||...|:............|:|.|  :
Human    93 VREGVVDLDLDELNVYARGTDYDMDFTLLVPALKLHDRNQPVTLDMRHSALCHSWLSLRLFD--E 155

  Fly   114 RSMSLWVEFIT-------ASGY-LSARKIRSRFQ---TLVAQACDKCAYR---DIVKMIADTTEV 164
            .::|.|.:..|       |:.| .|..|:...|.   ::|.....|...|   .:.|:..:.|.:
Human   156 GTISKWKDCCTIVDHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTII 220

  Fly   165 KLRI---RERIIVQITPAFKCAGLWPRSASHWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQG 226
            .:.:   ..|::..|.|.....| ||..|..|.:....| ...|..|....|| .|...| :.:|
Human   221 SIILGVGSSRMLYDIVPVVSFKG-WPAVAQSWLMENHFW-DGKITEEEVISGF-YLVPAC-SYKG 281

  Fly   227 KNSAMEGDAWVLSFTDAENRLLQGASRRRCLS--------ILKTLRDRHLDLPGNPVTSYHLKTL 283
            |    :.:.|.|||..:|.:|      ::|:|        ..|.:..:.|..| ..::.|||:::
Human   282 K----KDNEWRLSFARSEVQL------KKCISSSLMQAYQACKAIIIKLLSRP-KAISPYHLRSM 335

  Fly   284 LLYECEKHPREMEWEENCIADRINGIFLQLISCLQCRRCPHYFLPNMDLFKGKSPGALENAAKQV 348
            :|:.|::.|.....:|:..|..:.|:...|..||..:.||:||:|..::        ||:.:::.
Human   336 MLWACDRLPANYLAQEDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNM--------LEHLSEET 392

  Fly   349 WRLTRIMLTNVR 360
            ..|....|::||
Human   393 VMLHARKLSSVR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 72/325 (22%)
MB21D2NP_848591.2 Mab-21 176..401 CDD:308741 57/247 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.