DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and CGAS

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_612450.2 Gene:CGAS / 115004 HGNCID:21367 Length:522 Species:Homo sapiens


Alignment Length:396 Identity:87/396 - (21%)
Similarity:169/396 - (42%) Gaps:94/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVPSDMIAAQSKMVYQMNKYCADRVQVRKAQIHKQIQEVCRIVQDVLKEVEVQEP-RFISSLND 64
            :||..|.....||:     :...:::::.:..|......|..:|..:|..::.... |.:..||.
Human   152 ILVRRDAAPGASKL-----RAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLNT 211

  Fly    65 YNGRFEGLEVISPTEFEIIIYLNQMGVLNFVDDGTLPGCAVLKLSDGR-------KRS-----MS 117
             ...:|.:::.:|.||:::..|.            :|...:.:.|:.|       ||:     :|
Human   212 -GSYYEHVKISAPNEFDVMFKLE------------VPRIQLEEYSNTRAYYFVKFKRNPKENPLS 263

  Fly   118 LWVEFITASGYLSARKIRSRFQTLVAQACDKCAYRDIV--KMIADTTEVKLRIRERIIVQITPAF 180
            .::|    ...|||.|:.|:|:.::.:..:.....|::  :....:..|.|.|.|:|.|.||.|.
Human   264 QFLE----GEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLAL 324

  Fly   181 KCAGLWPRSASHWPLPGI---PWPHPNIVAEVKTEGFDMLSKECIALQGKNSAMEGDAWVLSFTD 242
            :....||.|...    |:   .|....:..:::.:.|.::.|.  |.:|  :..:.:.|.|||:.
Human   325 ESKSSWPASTQE----GLRIQNWLSAKVRKQLRLKPFYLVPKH--AKEG--NGFQEETWRLSFSH 381

  Fly   243 AENRLL--QGAS------------RRRCLSILKTLRD---------RHLDLPGNPVTSYHLKTLL 284
            .|..:|  .|.|            |:.||.::|.|.:         :|||    ..:|||:||..
Human   382 IEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLD----KFSSYHVKTAF 442

  Fly   285 LYECEKHPREMEWE--------ENCIADRINGIFLQLISCLQCRRCPHYFLPNMDLFKGKSPGAL 341
            .:.|.::|::.:|:        :||:.     .|||   ||:..:..:||:|..:||   |...:
Human   443 FHVCTQNPQDSQWDRKDLGLCFDNCVT-----YFLQ---CLRTEKLENYFIPEFNLF---SSNLI 496

  Fly   342 ENAAKQ 347
            :..:|:
Human   497 DKRSKE 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 75/328 (23%)
CGASNP_612450.2 DNA-binding. /evidence=ECO:0000269|PubMed:28363908 1..160 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..144
RecX 15..>117 CDD:294607
Required for association with the cell membrane. /evidence=ECO:0000269|PubMed:30827685 64..75
Required for activation upon DNA viral infection. /evidence=ECO:0000269|PubMed:28314590 120..160 3/7 (43%)
DNA-binding. /evidence=ECO:0000269|PubMed:30007416, ECO:0000305|PubMed:23707061, ECO:0007744|PDB:6CTA 173..215 7/42 (17%)
Mab-21 214..510 CDD:281298 75/328 (23%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:30356214 295..305 1/9 (11%)
DNA-binding. /evidence=ECO:0000305|PubMed:23707061 384..407 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.