DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mab-21 and tmem102

DIOPT Version :9

Sequence 1:NP_651971.2 Gene:mab-21 / 44127 FlyBaseID:FBgn0029003 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001314791.1 Gene:tmem102 / 100536810 ZFINID:ZDB-GENE-160728-39 Length:522 Species:Danio rerio


Alignment Length:201 Identity:48/201 - (23%)
Similarity:84/201 - (41%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TTEVKLRIRERIIVQITPAFKCAGLWPRSASHWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQ 225
            ||.:......||:..:.|.....| ||..|..|......| ...|..|....||.:|  .|.:..
Zfish   243 TTLILTAGTSRILYDLLPVVSFRG-WPAVAQGWLTTNHFW-DGKITEEEAISGFYLL--PCCSPA 303

  Fly   226 GKNSAMEGDAWVLSFTDAENRLLQGASRRRCL--------SILKTLRDRHLDLPGNPVTSYHLKT 282
            ..:|......|.|:::.:|.:|      ::|:        ...|.:..|.|..|...::.|||:|
Zfish   304 VSSSIRPDREWRLAYSRSEVQL------KKCVPYPMAQAFQAAKAVLSRLLARPRTGLSLYHLRT 362

  Fly   283 LLLYECEKHPRE-MEWEENCIADRI-NGIFLQLISCLQCRRCPHYFLPNMDLFKGKSPGALENAA 345
            |:.:.|::.|.. :...::....|: .|:...|..|:..:.||:||||..::.:..|..|....|
Zfish   363 LMFWACDRLPSTYLSCPDHETPARLFLGLLDDLAHCILGKNCPNYFLPQCNMLEHLSDSAALLVA 427

  Fly   346 KQVWRL 351
            :::..|
Zfish   428 RKLAHL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mab-21NP_651971.2 Mab-21 68..350 CDD:397398 47/198 (24%)
tmem102NP_001314791.1 Mab-21 <201..432 CDD:281298 47/198 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.