DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and GALR3

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_003605.1 Gene:GALR3 / 8484 HGNCID:4134 Length:368 Species:Homo sapiens


Alignment Length:320 Identity:113/320 - (35%)
Similarity:174/320 - (54%) Gaps:30/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAESVALE---RIVSTIVPVFFGIIGFAGLLGNGLVILVVV-----ANQQMRSTTNLLIINLAVS 119
            ||::::|:   .:.:..|||.|.:|...|.:|||||:.|::     |.|:..|||:|.|:||||:
Human     3 DAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLFILNLAVA 67

  Fly   120 DILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMS 184
            |:.|::.||||.||.|.|..|.||.:.||.|..:|.:|.:.|.:||..:|.||:|||.||:.|.:
Human    68 DLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRA 132

  Fly   185 LRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHG----NAGTACVFSTEEEIWSLVGFQVS 245
            |||.|||..|:...|:        :|...|.....|:|    .|...||.:.|:.  ......|:
Human   133 LRTPRNARAAVGLVWL--------LAALFSAPYLSYYGTVRYGALELCVPAWEDA--RRRALDVA 187

  Fly   246 FFLSSYVAPLTLICFLYMGMLARLWKS-APGCKPSAESRKGKRRVT----RMVVVVVLAFAICWL 305
            .|.:.|:.|:.::...|...|..||.: .|....:||:|   ||.|    |.::.|...:|:||.
Human   188 TFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEAR---RRATGRAGRAMLAVAALYALCWG 249

  Fly   306 PIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCG 365
            |.|.:::......:..|..:...::.||.:||.|||:||::||..|.:||..||::..||
Human   250 PHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRARFRRLWPCG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 65/165 (39%)
7tm_1 91..347 CDD:278431 95/269 (35%)
GALR3NP_003605.1 7tm_4 24..>162 CDD:304433 61/145 (42%)
7tm_1 34..291 CDD:278431 95/269 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3617
eggNOG 1 0.900 - - E33208_3B9CW
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1132
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.